SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021792 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021792
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-44
Family G proteins 0.0000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021792   Gene: ENSONIG00000017278   Transcript: ENSONIT00000021811
Sequence length 198
Comment pep:known_by_projection scaffold:Orenil1.0:GL831235.1:1446388:1452295:-1 gene:ENSONIG00000017278 transcript:ENSONIT00000021811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLLEWISSGFNSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHAQARRVWKNYLPAINGIVFLVDCADHGRLGESKAELDALMT
DETIGNVPILILGNKIDRPEAISEERLREIFGLYGQTTGKGNIPLKELNTRPLEVFMCSV
LKRQGYGEGFRWLSQYID
Download sequence
Identical sequences I3KKZ7
ENSONIP00000021792 XP_003451489.1.78416 ENSONIP00000021792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]