SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022025 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022025
Domain Number 1 Region: 7-105,136-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000116
Family G proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022025   Gene: ENSONIG00000017465   Transcript: ENSONIT00000022044
Sequence length 247
Comment pep:novel scaffold:Orenil1.0:AERX01074932.1:2:1338:-1 gene:ENSONIG00000017465 transcript:ENSONIT00000022044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RELQLVRDYKPHKDVQHLRIMLHGPPGAGKSSFINSVDSALRGKIATRALAAANFGASFT
NAYRTYKIQKGNPEMFYPFVFTDTMGLESGDEGAIHVEDIKLAMNGHVKEGYTFKPTALL
RESDPDYNSSPTLDDKVHIVVFVIPADRVSIISDKTWRKMKDVRLHARDKEIPQIALMTR
IDEACPEVKKDIKNAYRSKYLNQLVCSRKCKQCIPPNCIFLVKNYHTEIETDNDVDSLIL
SVLKKII
Download sequence
Identical sequences I3KLN0
ENSONIP00000022025 ENSONIP00000022025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]