SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022106 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022106
Domain Number 1 Region: 36-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.67e-36
Family Ankyrin repeat 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022106
Domain Number - Region: 273-315
Classification Level Classification E-value
Superfamily SOCS box-like 0.00863
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022106   Gene: ENSONIG00000017532   Transcript: ENSONIT00000022125
Sequence length 323
Comment pep:known_by_projection scaffold:Orenil1.0:GL831174.1:386162:388680:-1 gene:ENSONIG00000017532 transcript:ENSONIT00000022125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMVLGRAANMSLMDISKIFSLLQPKEEDEDGELSQALNNAVSGDDVALLSELLSQEDYRK
SINARSGWGVPVTPLRTAAALGHLRCLELLLEHGAAVDSLDVKAQTPLFTAVSGKHLDCV
VALLNAGADPNGSQYNNCSPVLTAAREGDVDILRELLRFGAEVDVKPKVPEWASNATACR
GPLYISAVYGHLDCFKLLLLHGANPNYNCTDEKMLARIKQPKTVLEVCLRYGCGVEYIQL
LIDFGADVYLPTLIIDKTTKQNEALLLLLKERVCPKPLMSQARLAIRGYLAFANKEPAID
SLDVPLILRNYLKHETSDVIFIH
Download sequence
Identical sequences I3KLW1
ENSONIP00000022106 ENSONIP00000022106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]