SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022228 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022228
Domain Number 1 Region: 816-997
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-49
Family SPRY domain 0.0018
Further Details:      
 
Domain Number 2 Region: 614-823
Classification Level Classification E-value
Superfamily RNI-like 1.96e-30
Family 28-residue LRR 0.0013
Further Details:      
 
Domain Number 3 Region: 2-80
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000153
Family Pyrin domain, PYD 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022228
Domain Number - Region: 189-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00193
Family G proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022228   Gene: ENSONIG00000017625   Transcript: ENSONIT00000022247
Sequence length 1010
Comment pep:novel scaffold:Orenil1.0:GL831449.1:278703:292202:1 gene:ENSONIG00000017625 transcript:ENSONIT00000022247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEPVQTQLLEILEGLGDKELKYFKWYLQKSELLDGLPAIPKSDLQICDKQKTVNVIINI
YKTEDALDVTRKILDKVKTRTNKQPQGVVKQPARAVTSQDVLKNCQVKLKSVLKKEFQCV
FEGIAKAGNPNLLNQIYTELYITKGETTEVNDEHEVRQIETASRKPDKPETTIRREDIFK
SSPGRDAPIRTVLTMGEAGIGKTVLTQKYTLDWAEDKSNQDIQFIFPFTFRELNMLKEEK
FSLVELVHHFFTETTEAGICSFEDFQVVFIFDGLDECRPPLDFNNTESVTDITESTTVHA
LLTNLIRGKLLPSAILWVTTRPAAANQIPPDYVDMVTEVRGFTDPHKEEYFRKRSRDDAS
RIISHIKTSRSLHIMCHIPVFCWITATVLEDVLKTRDGGQLPKTLTEMYIHFLVVQAKVK
KVKYDGGAESDPHWSPESRKMIESLGKLAFDQLQKGNLIFYESDLTECGIDIRAASVYSG
VFTQIFRKERGLYQDKVFCFIHLSVQEFLAALHVHLTFINSGLNLLEEQRTLSQFNRRNS
YDRLIFFQSAVDKALQSPNGHLDLFLRFLLGLSVEANQTLLRGLLPQTESSSQTNKETVQ
YIKKKLSENLSAEKSINLLHCLNELKDRSVVKKIQLSLRSGSLSTDKLSPAQWSALVFIL
LTSEVDMDVFDLKKYFPSEEGLLSLLPVVKASNNALLSGCHLSERSCKALSSVLLSQSSS
LRKLDLSNNDLKDSGVKLLLAGVASPHSKLETLSLSGCLITNEGCASLASSLISNPAHLK
ELDLSYNNIGDSVEKLRDLLKLETLRVEPAGVRWLRPGLRKYSCQLTIDTNTVHTNLKLS
ENYRKVTRVKEVQSYPDHPDRFDYHPQLLCRNGLTGRCYWEVEWRGDVFISLSYRRIQRK
GGSDNCVFGWNDQSWSLYCTDNGPCSVWHSNRLTSISSSSSVSNKVAVYVDCAAGTLSFY
RVSSDTLIHLHTFNTTFTETLYPGFIAWPGSSLFLCSVECKQCPPVREKL
Download sequence
Identical sequences I3KM83
ENSONIP00000022228 ENSONIP00000022228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]