SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022301 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022301
Domain Number 1 Region: 271-379
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.27e-23
Family PWWP domain 0.0068
Further Details:      
 
Domain Number 2 Region: 134-264
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000000116
Family Bromodomain 0.0033
Further Details:      
 
Domain Number 3 Region: 95-158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000244
Family PHD domain 0.013
Further Details:      
 
Domain Number 4 Region: 561-604
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000105
Family MYND zinc finger 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022301   Gene: ENSONIG00000017687   Transcript: ENSONIT00000022320
Sequence length 606
Comment pep:known_by_projection scaffold:Orenil1.0:GL831411.1:114187:140974:1 gene:ENSONIG00000017687 transcript:ENSONIT00000022320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVVKKRQADPKVVQYVWEAIEVIRNQKQIANMDRISKYLSRVFGMHPKETARQLSLAV
KDGLVVETLTVGCKGSKAGIEQEGYWLPGDEMDWETESHDWYCFECHLPGDVLTCDNCFR
VYHLKCLSDECKPRDGGSPWQCVVCRGSKKKNLNKQEMCKYLRFIVQRMKERAVDLNKKG
KDTKHPMYRRLIHTALDVSNIQENLSEGKYKSFEEFKADAQMIVHNTAILYGVHSDQAEI
ARLLFSDTCHELNELLLCKNCFYLSNARPDNWFCYPCSPSHDLVWAKMKGFGYWPAKVLQ
REDNQVDVRFFGHQHQRAWIPSENIQDIKVSVQQLQVKRSNGWKKACEELEVYQRFLREG
RFWKTKMEDGLERTDEAESSISSTSNEQLKGSQEPKAKKSRRTHTVEPKEEDPEPEMEAV
SSSQEIPVSSAPQQPEKLSVSTQTKKANGGSPRTLHRGTQTNSDGACQNMCHEKYTKVFN
DVKEMMKADNKRETERVVREALEKLRAEMEEEKRQAVSKAVAGAQAEMERKCKQVKEKCK
EELVEEVKKLVAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKR
TCRRKR
Download sequence
Identical sequences I3KMF6
ENSONIP00000022301 ENSONIP00000022301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]