SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022382 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022382
Domain Number 1 Region: 36-61,179-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-51
Family G proteins 0.00000888
Further Details:      
 
Domain Number 2 Region: 65-186
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.27e-33
Family Transducin (alpha subunit), insertion domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022382   Gene: ENSONIG00000017752   Transcript: ENSONIT00000022402
Sequence length 361
Comment pep:known_by_projection scaffold:Orenil1.0:GL831321.1:1373476:1412971:-1 gene:ENSONIG00000017752 transcript:ENSONIT00000022402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCLGTEVTEEQKKARIHSAKIDRELYESAKREMNVVKILILGAAESGKSTLVKQMKII
HSNGFTKQELCTFKPAVLDNLLTSMKFVLHGMGTLRINLANSRNKVHAHSVLSCGRCFDE
DQVLFPFLSHALSCLWADQGVRAAAARGYEYELNDSALYFFENMSRIMSPEYVPTETDVL
RVRLRTTGVIETQFKVNHLIFRMYDVGGQRTERRKWIGCFEDVRAVLFVVSLSGYDMTLV
EDPSVNRLQESMKLFSSICNNIYFRSTSMILFMNKIDLFQDKILHFGRHLRLYLPQFKGA
DCDVDSAARFIATTFISLNKTPSKLIYHHFTTATDTSNIQIVFQVVMETIIKENLEAVSL
L
Download sequence
Identical sequences I3KMN7
XP_003455811.1.78416 ENSONIP00000022382 ENSONIP00000022382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]