SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022388 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022388
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-64
Family G proteins 0.0000000413
Further Details:      
 
Domain Number 2 Region: 339-442
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.55e-44
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000344
Further Details:      
 
Domain Number 3 Region: 239-335
Classification Level Classification E-value
Superfamily Translation proteins 2.21e-29
Family Elongation factors 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022388   Gene: ENSONIG00000017758   Transcript: ENSONIT00000022408
Sequence length 463
Comment pep:novel scaffold:Orenil1.0:GL831441.1:517029:529725:-1 gene:ENSONIG00000017758 transcript:ENSONIT00000022408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDIALWKLEDSPKFVKILIERPRTQEFIKDKHFHTRQADCAVLIVAAG
VGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRFEEITKEVSAYIK
KIGYNPATVAFVPISGWHGDNMLEPSDKMAWFKGWKIERKEGGATGTTLLEALDSIMPPT
RPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPPNLTTEVKSVEMHHESL
SEALPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPQAAENFTAQVIILNHPGQIAQGYAP
VLDCHTAHIACKFSELKEKIDRRSGKKLEDNPKALKSGDAAIITMVPGKPMCVESFSQYP
PLGRFAVRDMRQTVAVGVIKSVEKKAATGGKVTKSAQKADKKK
Download sequence
Identical sequences I3KMP3
ENSONIP00000022388 ENSONIP00000022388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]