SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022648 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022648
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.98e-60
Family G proteins 0.0000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022648   Gene: ENSONIG00000017974   Transcript: ENSONIT00000022668
Sequence length 193
Comment pep:known_by_projection scaffold:Orenil1.0:GL831283.1:1595977:1600218:-1 gene:ENSONIG00000017974 transcript:ENSONIT00000022668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKSEEAREMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGRKSGCLLL
Download sequence
Identical sequences I3KNF3
ENSONIP00000022648 XP_003454292.1.78416 XP_004545965.1.88231 XP_004545966.1.88231 XP_005745941.1.53837 XP_005745942.1.53837 XP_005943515.1.24487 XP_005943516.1.24487 XP_006804354.1.46954 XP_006804355.1.46954 XP_006804356.1.46954 ENSONIP00000022648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]