SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022698 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022698
Domain Number 1 Region: 40-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-29
Family G proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022698   Gene: ENSONIG00000018012   Transcript: ENSONIT00000022718
Sequence length 346
Comment pep:known_by_projection scaffold:Orenil1.0:GL831193.1:364693:374282:-1 gene:ENSONIG00000018012 transcript:ENSONIT00000022718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSFSIDMSDIVPPEVRPKPAVPAKPPNSSSGGSTLLGYIGIDTIIEQMRKKTMKTGFDF
NIMVVGHSGLGKSTLVNTLFKSQVSRRSAGWARDEKIPKTVEIKAVSHVIEEGGVKMKLT
VVDTPGFGDQINNDNCWEPISKYINEQYEKFLKEEVNITRKKRIPDTRVHCCLYFISPTG
HSLRQLDTEFMKRLSHSVNIIPVIAKADTLTIEERQEFKQRVRKELEMSGIEFYPQKEFD
DDMEDKSDNDKIRQEAMPFAVVGSDKEYQVNGKRVLGRKTAWGIVEVENPNHCEFAQLRD
FLIRSHLQDLKEVTHNIHYETYRAKRLNENGGLHPISSAETQESNL
Download sequence
Identical sequences I3KNK3
ENSONIP00000022698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]