SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022921 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022921
Domain Number 1 Region: 554-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-64
Family Tandem AAA-ATPase domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 694-754,1712-1893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-64
Family Tandem AAA-ATPase domain 0.0000904
Further Details:      
 
Domain Number 3 Region: 798-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000106
Family Tandem AAA-ATPase domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022921   Gene: ENSONIG00000018197   Transcript: ENSONIT00000022941
Sequence length 2222
Comment pep:known_by_projection scaffold:Orenil1.0:GL831200.1:2005178:2031160:-1 gene:ENSONIG00000018197 transcript:ENSONIT00000022941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKKNPLHPCPLHSQVRQWIADRVTGNSSPGSPSTFSYPGSSSTPDWSTPRRERSSPLRG
PHGKFVSPSSLGAYSLSSSPPDQGSSQRSRSERHTDMAELAKHEADIEHRTQALKREGFW
SMKRLTRLTEPPRPKVHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVMRHHEELRQK
EEKAKRDEHAKIRRVASSIAKEVRAFWSSVEKVVQYKQQSRLEEKRKKALDLQLDFIVGQ
TEKYSDLLSKSLAPIRPAETVVSPQKSLPNPVDEDDRDFEPPCEEEDDEETIEVEEQQEG
NDAESHRREIELLKEEGMLPLDQLLSSLNLPQVGPQTRGHWFCSHLSKTNDGPRIMIHYD
DLLFILETFPPPAAEIMDHVKSEAGEEEDGEFTANEEDAEDEEDTIAAQEKVEGNVDHAE
ELDDLAKEGDMSVEELLEKYKGAYASDFEVPSTSGSKASSDSEVSGDEEVETEEDESDVE
SNTSSSDSPGDSAEDEESEKDEEESEEEDEEECGDEGMEVLLKEGDSSPSSSGSRPKKEI
SHIAATAESLQPKGYTLATTKVKTPIPFLLHGTLREYQHIGLDWLVTMYEKKLNGILADE
MGLGKTIQTIALLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPGFKILTYFGSQKE
RKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKSWRYLILDEAQNIKNFKSQRWQSLLN
FNSHRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEG
LVKRLHKVLRPFLLRRIKADVEKQMPKKYEHVVRCRLSKRQRFLYDDFMAQASTRETLAS
GHFMSVINILMQLRKVCNHPNLFDPRPIQSPFIMQPIIFHTASLVQDGLEVSPLKRCDVS
MFDLIGLESRVSRYQADVFLPRYKVSRQLIQEIMESPEPPPRPKPVRMKVNRMFQPPPKG
DNRPVLLMNKPTCSVPPAAQTPKPPPVTEVTSAPAPAPVVQQVSVVCSIAPTPPRPSLHP
TAQTAVRSNAPKPMLTVRPPTAPCTAAIPAQPSPNPSNVMPQRVLLSPDMQARLPSGEVV
SIAQLASLAGRPVSSCQGSKPVTFQLQGNKLTLSGAQIHQVPAASSRPVQGNVINLVPGG
VQHHLISQAAQVAVQSTVSTHPANNPSAAPPANRLPHNTTSQVSSTMVSSPGVVKIVVRQ
STGKEGGPVPTLAVAPSPRVAPQASPSLHTHANTTPIRNTAPLQIAQRTPGPATAHYTIA
PPRNPSSALNQPQPPRPVLKVVQPPPPSSTEQPALFLLSPNNLQVNKILCIMKHTCKKVF
LRGRFLFCLSAAPAQVSTSSSAPKTSATPRESSSSSQTAVSTKSKSKAFPPPRKVPRPAP
RSPFYMVSSLSLWTSPVIYLKHLQSFFEVLPNTSSPRTMHQSYGDMNWDVSKLKRCMKHQ
LKKTNKQTLCVPNLRVMELIQSAGLRSLKLNYMIKEVSLLRTDQDKFVILILPVAVVAKL
FQQVVALQRWSSLSMSNKFVMFISAAPNWLRKSITIIFFSIVHLNKTEPDIRPPFTCISL
PQQSWLADSEKQQHDSRLDFIFRVNELHCGAKPMYGQEVLDFLTFLPGHRPSPAALNPQG
QNKHDYWFHSHAVREAIHSIEGRLELLSDIIDRYTFAIPPVEAPPISMHCCHPPPSLNHK
QAVFSSMLSAEVTPLTRSLHRVQSYMRTQFPDLRLIQYDCGKLQTLHTLLRKLKAGGHRV
LIFTQMTRMLDVLEQFLNYHGHIYLRLDGSTRVEQRQALMERFNADRRIFCFILSTRSGG
VGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQ
KRMLGDMAIEGGNFTTAFFKQQTIRELFDVNEGEKREAAVELSVPQAEEEEAVNKQSTTI
LEQALCRAEDEEDIVAASQAKAEQVAELAEFNENIPLDDGGEQEEVEELSKAEQEIAALV
EQLTPIERYAMNFLEASLEDVCKEELKQAEEQVEAARKGLDQAKEEGLKLHTSSDDDEDD
FLSTPTSVEPAHPAPARRGRKPKDKTATSTRTSGRLRGASPETEPEPTTPREVPERSRSV
PSPPTASPPAVSLPTPPAPQVTSPISEPASPQVVASAPAPCPAPAPVLSSSTYTSTPVSN
TASSPPVSDVSPPPPASSPVCTPPPTTPSTSAATPAEAKKASAASSTPAGVTTPSTAAPS
EV
Download sequence
Identical sequences I3KP76
ENSONIP00000022921 ENSONIP00000022921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]