SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022967 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022967
Domain Number 1 Region: 56-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.35e-290
Family Motor proteins 2.24e-16
Further Details:      
 
Domain Number 2 Region: 859-984
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.84e-24
Family Myosin rod fragments 0.00024
Further Details:      
 
Domain Number 3 Region: 979-1094
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.54e-20
Family Myosin rod fragments 0.0016
Further Details:      
 
Domain Number 4 Region: 1255-1373
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000000497
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number 5 Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00000863
Family Myosin S1 fragment, N-terminal domain 0.00094
Further Details:      
 
Domain Number 6 Region: 1370-1476
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000165
Family Myosin rod fragments 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022967
Domain Number - Region: 1084-1174
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000471
Family Myosin rod fragments 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022967   Gene: ENSONIG00000018235   Transcript: ENSONIT00000022987
Sequence length 1564
Comment pep:known_by_projection scaffold:Orenil1.0:GL831193.1:3063647:3122453:-1 gene:ENSONIG00000018235 transcript:ENSONIT00000022987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQRSGQEDPERYLFVDRAVVYNPAAQADWTAKRLVWIPSERHGFEAASIQQERGDEVVV
ELAENGKKAVINKDDIQKMNPPKFTKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPPESPKPVKLQSGPLFYGELERQLLQANPI
LESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIF
YQLLAGAGEHLKSDLLLEGFNNYRFLSNGNIPIPGQQDKDNFHETMEAMHIMSFGHEEIL
AMLKVVSSVLQFGNIVFKKERNSDQASMPDNTAAQKLCHLLGMNVMEFTRAILTPRIKVG
RDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFE
IFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIER
PANPPGVLALLDEECWFPKATDKTFVDKLIQEQGTHTKFQKPRQLKDKADFCIIHYAGRV
DYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGATYK
TKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGV
LEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIHALELDPNLFRIG
QSKIFFRTGVLAHLEEERDLKITDIIIYFQSVCRGYLARKAFAKKQQQLSALKVLQRNCA
AYLKLRHWQWWRLFTKVKPLLQVTRQEEELQAKDEELVKVKERQLKVENELVEMERKHQQ
LLEEKNILAEQLHAETELFAEAEEMRVRLLSRKQELEEILHDLESRVEEEEERNQSLQNE
KKKMQSHIQDLEEQLDEEEAARQKLQLDKVTAESKIKKMEEDILLLEDQNSKFLKEKKLL
EDRIAEMTSQLTEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAET
TDLQDQIAELQAQIEELKIQLAKKEEELQAALARCDEESVQKNNALKQIRELQAQIAELQ
EDLESEKMCRSKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRSKREQEVAELKKAID
EETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQCLENDNKELVCEVKALQ
QAKTESEHKRKKLEAQLQESLTRATEVERAKGELAERSHKLQTELDNVSTLLEEAEKKGV
KLAKEVENLNSKLQDSEELRQEETRQKLNLSGQIRQLEADKNNLLEQQEEDEEARRSLEK
QLQTVQAQLFETKKKLEEDVGAMEGLEEVKRKLQKDMELTNQRLEEKTISLDKMEKTKNR
LQQELDDQMVELDLQRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKETK
ALSMARALEEALEAKEELERFNKQLRAEMEDLMSSKDDVGKNVSDLLTSPVTLLIKRCSH
VRNT
Download sequence
Identical sequences I3KPC2
ENSONIP00000022967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]