SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023033 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023033
Domain Number 1 Region: 515-792
Classification Level Classification E-value
Superfamily RNI-like 1.03e-51
Family 28-residue LRR 0.00026
Further Details:      
 
Domain Number 2 Region: 781-960
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-46
Family SPRY domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023033
Domain Number - Region: 95-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000974
Family G proteins 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023033   Gene: ENSONIG00000018294   Transcript: ENSONIT00000023053
Sequence length 965
Comment pep:novel scaffold:Orenil1.0:GL831915.1:187:28538:-1 gene:ENSONIG00000018294 transcript:ENSONIT00000023053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLDSDPSAQQGEVMCQPKLKSLLKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTAE
VNDEHEVRQIETTSRKPDRPETTIRQEDIFKDTPERQDLIRTVLTKGVAGIGKTVLAQKY
TLDWAEDKANQDIQFIFPFTFRELNVLKEEKFSLVELVHHFFTETKEAGICSFEDFQVVF
IFDGLDECRLPLDFHNTKSVTDVTMPTTVDVLITSLITGKLLPYAHVWITTRPAAADQIP
PEYVHRVTEVRGFTHPQKEEYFRKRFRDEEQASRIISHIKTSRSLHIMCHIPVFCWITAT
VLEDVLETREEGQLPKTLTEMYIHFLVVQAKVKKVKYDGGAETDPHWSPESRKMIESLGK
LAFDQLQKGNLIFYESDLTECGIDIRAASVYSGVFTQIFKEERGLYQDKVFCFIHLSVQE
FLAALHVHLTFINSGLNLLKKRSLKSLHQSAVNKALQSPNGHLDLFLRFLLGLSLQTNQT
LLRGLLTQTGSTSSTNQETVQYIKKKLSENLPAEKSINLFHCLNELNDHSLMEEIQQSLR
SGHLSTDKLSPAQWSALVFILLSSEKDLDEFDLKKYSASEEALLRLLPVVKASNKALLSG
CNLSERSCEALCSVLSSQSSSLRVLDLSNCDLQDSGVKLLSAGLQSLNCKLNTLRLSGCN
LSERSCEALCSVLSAQSSSLRELDLSNCDLQDSGVKLLSAGLKSSQCAVETLSLSGCLIT
EEGCTSLASALSFNPSHLRELDLSYNHPGDSGMKLLSAGLKDPGWRLDTLRVEPAGVRWL
RPGLRKYSCQLTIDTNTVNTKLQLSDNNRKVTRVEEVQSYPDHPDRFDAYQQLLCRNGLT
GRCYCEVEWRGNVYMSVSYRSIRRKGGSRDCWFGHNDQSWSLWCTEDGPQSVWHNKRQTL
ISSSSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFNTTFTDTLYPGFMVWPPGS
TVSLC
Download sequence
Identical sequences I3KPI8
ENSONIP00000023033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]