SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023235 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023235
Domain Number 1 Region: 92-119,240-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.15e-63
Family G proteins 0.00000000755
Further Details:      
 
Domain Number 2 Region: 175-244
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.44e-25
Family Transducin (alpha subunit), insertion domain 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023235   Gene: ENSONIG00000018456   Transcript: ENSONIT00000023255
Sequence length 436
Comment pep:known_by_projection scaffold:Orenil1.0:GL831198.1:840584:894835:1 gene:ENSONIG00000018456 transcript:ENSONIT00000023255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGDPARLPAGEHRRGDTGTDGVLIQNGGGGGGGSGKGTGKDRGRRLQLLQKTSTQKQKNC
DKLLVEEKEAEKEAKKVSKNIDRVLKELKREYKQTHRLLLLGAGESGKSTIVKQMRILHV
NGFNAENFNLRRRDLRQSSSSQSAEPVLSAESHVVPPCWTMNFFHNFPCDATSLLCHCQE
IWDFTQEFFDHAKKLWDDEGVKACFERSNEYQLIDCAQYFLDRIDSVRQSDYTPTDQDLL
RCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIR
EDNNTNRLREALDLFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYARY
TIPNEATPEPGEDPRVTRAKFFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFND
CRDIIQRMHLRQYELL
Download sequence
Identical sequences I3KQ40
ENSONIP00000023235 ENSONIP00000023235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]