SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023400 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023400
Domain Number 1 Region: 2765-2889,2923-3043
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-24
Family Extended AAA-ATPase domain 0.087
Further Details:      
 
Domain Number 2 Region: 1808-2019
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-22
Family Extended AAA-ATPase domain 0.031
Further Details:      
 
Domain Number 3 Region: 2430-2694
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.53e-16
Family Extended AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 4 Region: 2040-2246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000289
Family ABC transporter ATPase domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023400   Gene: ENSONIG00000018590   Transcript: ENSONIT00000023421
Sequence length 4472
Comment pep:known_by_projection scaffold:Orenil1.0:GL831198.1:2845552:2878414:1 gene:ENSONIG00000018590 transcript:ENSONIT00000023421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLRLFMPDLSQICLTGICCYFIRTREDIAVNSENVHEEIFFSVVDARDGLLKGIRNAYNV
LLPALDAPQNWGTIESRHGVKCKENLMYTIKHCLDSLEEIQISNKYIVHLTTFTHIDFSK
LATLNDMKTAAANCELVHQLEKILLQLCKEIEQVLIESEQLRKGADSEGPLSDLEHWKGM
SIRFNSIITHIKSQECRTVIMVLHISRSKTVKMWRKLDTRITRCANEAKDNVKFLNTLEK
VLQPLYISDPVTMMTNVQNVISTIHMIFRVSLYYNTTETISSLFIKVTNQMVTMCRSYIT
DNGKCLIWDQDPDNIITKVQHCTSLYQEYKSCFQKTKMETVAASGKRPFEVSEMEIFLKF
SNFCKQLEKITQIVTVFKTFESLNKSNIEGIEILARQFNTIAMNMKSKQYDMLAPRSAEF
GADFVKFTEQIRYIENQLQTFMNSCFSHVRTSERAIHLIQRFQRLNIPCINAHVPHLLGL
ILQRYVSEVEFVRKHYGNHKENPPLARDMPPVAGRIGWARHLFKKIEEPMLHIKENSDIL
LSPQGRNAVKMYNQTAASLVKFECIYYQAWLEEVSQMNHVLNVALLVRHPKTGKLVVNFD
PKVTEVIWEAKCLLKMDLLVPKQALHLLNIETKLNADHHRLQTILEDYESTCEKIPEDFS
SWMASKIQNVESALQRGAVLFTWSSLLLDEFFQRVDAALYELQHLVNKVLNINKLHIDDV
LKDISETMLIELSDDPTSVQHLIDHNKNLCKEWAKTFDYKCSHVKTAIKELETILSAVYE
PKGYKTVQEPVSGERQTIAHEDERGTAESSIKDKNTKFEKEFKKLYESYTARVLDAVLKT
TKSSLNTLKKRISCAISYKKSKPQPRIVPLIKSEVQLDIPNVVMIPTLDEIQQAINQLTD
SVLKVSKSIAWQWEYTPNERKKTGANTLDAQVQSSAPKLKTSFIMVVPCREKNHLFNFVV
EHKDIKKLVGILKTAINSQKGQAADVLKQFSTFRAIWEEDKNAKVKEFMGSNPSLIHITD
EIQHYDSVEQEIQAIKPVIAFESVQLTTGSLKKALTDETKAWKKLICKYLKERYKKKMTD
THVHLNNYLIQLSHPVANLEDVRCTMGVLSTLREAEIETDMTLISIEEAYEILTKYEAEE
TKREVEEVYNLRDSFTMLQSKARSVQYELVRMQPKFQQDLVESVVIFQKDVDTFMEQFDS
EGPLVEGLAPQEASRRLQIYQARFEELWRNFTTYTSGHQLLGLPVIQYNCLHEKRRDLDL
LQKLYGLYDAVMNRINGYYKILWTQVDIEKINGELLDFQNRCRKLPKALKDWQAFLDLKK
TIDDFNDSCPLLEMIANKSMKRRHWDRIAQVTGHQFEVESSTFTLENIMEAPLLTYKDDI
EDICISAVKEKDIEAKLSQVKELWSAQTLSFMTFKSRGELMLKGAETSEILTNLEDSLMV
LGSLLSNRYSTFHKAEIQDWVFKLSTSSEVVEQWVIVQNLWVYLEAVFVGGDIAKDLPQE
ANRFQNIDKSWTEIMWRAQKVPNVVECCVGDPSLRENLPDLQKQLELCQKSLAGYLEKKR
LLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKEAEFHKTEYDKIIAVISQEGE
KLPLESPVMAQGEVEIWLGKLLVQQQASLHSVIRAADLEIDDKEFDLLAFLNKFQAQVGL
LGIQMIWTRDAEKALHHAEDDKHIMPLTQKKLLSLLTTLIKQTTYDLSKFDRVKYETLVT
IHVHQTDIFNDLVKKRIKSVGDFEWLKQSRFYFRGYLDKVIVSITNVDFIYQNEFLGCTD
RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMD
FRGLGRIYKAGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIVLTARKNQKRTFIFTDGDT
VDLNPEFGLFITMNPGYAGRQELPENLKVQFRTVSMMVPDRQIIMRVKLASCGFNENIIL
AQKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRARPDDTESSIVMRVLRDMNL
SKLLKDSSQIFDSIYINDLFPGIQLDGSTYAELQAAVAHQVQSAGIINHPPWNLKLVQLY
ETSRVRHGLMTLGPSGAGKTTVINILMRAMTECGYPHREMRMNPKAITAAQMFGRLDAAT
NDWTDGIFSTLWRRTLKAKKGEFIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRISM
SPCCKLVFEVHNMDNASPATVSRVGMVFMSSSALSWKPILRGWANKRNAKEAERILSLYD
KIFEDAYLYMKQNLKPKMELLECNYIMQSVNLLEGLLPTKETGGFAGSKHLERLFAFCLM
WSLGALLELDDRDKLETYIRGHESNIDVPPTQPGETMFEYMIGTNGDWCHWNNHVGEYIY
PTDHLPDYTSILVPNVDNTRTSFLLDTIAKQHKAVLLIGEQGTAKTVMIKSYTKKYDPET
DLSKTLNFSSATEPLMFQRTVESYIEKRIGSTYGPPGGRRMTVFIDDINMPVVNEWGDQI
TNEIVRQMMEMSGMYSLDKPGDFTTIEDVQILAAMIHPGGGRNDIPQRLKRQFTVFNCTL
PSNTSIDKIFGIISGGYFHECRKFKQSISDMVKRLVSAGRILWQWTKVKMLPTPSKFHYI
FNLRDLSRIWQGMLNIKAEECHDIPTLLALFKSECTRVIADRFICSEDREWFEKGVSRVI
QERVDPSLVPKLHPEPYFVDFLRDAPEPTGEEGEDACFDAPKIYELVPNFKFLSEKLMMY
QTQHNEIIRGSTLDLVFFTDAMTHLVKISRIIRTDQGNALLVGVGGSGKQSLTRLASFIA
GYRIFQITLTRTYNMTNFLDDLKVLYRTAGAEGKGITFIFTDNDIKNEAFLEYLNNVLSS
GEVSNLFAKDEIQEITQNLIPVMKKEFPRIPPTFDNLYEYFISRSRKNLHVVLCFSPVGP
KFRSWSLKFPGLISGCTMDWFTPWPNEALVAVSKYFLSEFNMVCSAEVKASVVTAMGTYH
DKVSVACESYFERFRRRTHVTPKSYLSFINGYKTLYTEKYNSINILAERMNVGLEKLKEA
SESVAQLSKELKVKEKELAIASVKADKVLAEVTVSAEAATIVKNEVQVVKDKAQTIVEGI
GKEKIVAEAKLEAAKPALEEAKAALNTIKPADVATVRKLAKPPHLIMRIMDCCLLLFQKK
LDSVSIDPERQCLKPSWAEALKLMSATGFMMSLQHFQNDKINGESVELLQPYFDMEDYTM
ENAKKVCGNVAGLLAWTRAMSTFFGINKEVLPLKANLAVQENRLRIANNELMKAEAQLAE
KQAEFDKVKAKCDAAMKEKQDLLDDAEKCKNKMQAASALIDGLSGEKVRWTEQSKEFKSQ
INRLVGDVLQLTGFLSYCGPFNQSFRNMLLKDIWEAELKSNKIPFTENLNIISALVDPPT
ISEWNLHGLPGDDLSVQNGIIVTKATRYPLLIDPQTQGKAWIKKKEMANSLQVTSLKHKF
FRNHLEDSLSLGNPLLIEDIAEDLDPVLDNVLEKNFVKSGTSFKVKVGDKEVNVMDGFQL
YITTKLPNPAYSPEVSAKTSIIDFTVNMKGLENQLLGRVILREKQELEAKRLNLIKDVTA
NKRKMQELEDNLLYKLSSTKGSLVDDDSMIGILTTTKQTAAEVSAKLSVAAEAEVNINIA
QAEYRPVASRGSILYFLITEMSMVNVMYQTSLSQFLKIFDLSLERSEQSPKTQKRIANII
EYLTFEVFRYTVRGLYENHKFIFTLLLALKIDLQNNKIEHNKFQVLIKGGAALDLKTCPP
KPFSWILDMVWLNLVELSKLPQFTNIVKQVAQSGKQWKAWVNLDAPEEGVIPDGYNSLDV
FHKLLLIRSWCPDRTLSQAVKYVGDSLGMRFAEPVILNLHSTWEESDPRTPLICFLSMGS
DPTEQIEALAKKLQLKCSAISMGQGQEVHARKLVNTSMIEGGWVLLQNCHLGLEFMDELL
ETITAADTMHNTFRVWITTEPHNRFSITLLQSSIKFTNDPPQGIRAGLKRTFAGISREQM
EVCDLPIWKPLLYSVAFLHTAVQERRKFGPLGWNIPYEFNSADFTASVEFVEKHLDDCCC
KKDVSWVTVQYMLAEVQYGGRVTDDYDKRLLKCFSRVWFSKKMFDPAFCFYTGYKIPVCE
TVEEYMEYIQSLPTVDSPQALGLHPNADITYQTNTSAEVLDTITNIQPKESGGGSGVTRE
SVVYNMAQDMLEKLPPNYVPHEVKARLSKMGVLNPMNIFLRQEVDRMQRIISLVRISLTD
LKLAIDGTIIMSENLRDALDNIFDARVPNLWRKISWESSTLGFWFTELLERNKQFHSWVF
EGRPKTFWMTGFFNPQGFLTAMRQEVTRANKGWALDTVTLNNKVLKHTKEEIKASPTEGV
YVYGLYVDGAGWDRKNARLIESSPKVLFTPLPVIHMFAVNSTAPPDPKLYVCPIYKKPKR
TDLNYITAVVLPTVESPDHWILRGVALLCDIK
Download sequence
Identical sequences I3KQK5
ENSONIP00000023400 ENSONIP00000023400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]