SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023474 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023474
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-89
Family G proteins 0.00000000027
Further Details:      
 
Domain Number 2 Region: 516-623
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-26
Family Pleckstrin-homology domain (PH domain) 0.00000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023474   Gene: ENSONIG00000018649   Transcript: ENSONIT00000023495
Sequence length 834
Comment pep:known_by_projection scaffold:Orenil1.0:GL831264.1:891244:915327:1 gene:ENSONIG00000018649 transcript:ENSONIT00000023495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLINSSAEWAEFLHCKGKKFTDFDEVRQEIEGETDRVTGANKGISPIPI
NLRVYSPNVLNLTLIDLPGITKVPVGDQPADIEQQIRDMIMQFITRESCLILAVTPANTD
LANSDALKLAKDVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGRKDIKAALEAERKFFLSHPAYRHMAEKMGTPRLQKILNQQLTNHIRDTLPAFRSKL
QSQLLALDKEAEEYRGYRPDDPSRKTKQLLQMVQQFSVDFEKRIEGSGDQVDTVELSGGA
KINRIFHERFPFELVKMECDEKEMRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQVIKL
KEPCVKCVDMVIQELINTVRQCSNKLECFPRLREETERIVTSHIRDRESRAKDQVLLLID
IQLSYINTNHEDFIGFANAQQRSSQTNKSQSSAGNQVIRKGWLTINNISIMKGGAKEYWF
VLTAESLSWFKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFCIFNTESRNVYKDNRTL
ELACDSQDDVDSWKSSLLRAGVYPEKTITVESETTTSTDNFSMDPQLERKVETIRNLVDS
YMAIVNKCIRDLMPKTIMHLMINNVKDFINAELLAQLYSAGDQNALMDESQEQALRRDEV
LRTHQALKEALAIIGDISTSTITVPLPPPVDTSWMGGSTGGRRSPPPSPTAPRRMSSGQR
PAPRGAPPPPNRPGPLGPFNNSADSPQAPSRPNRAPPSIPSRRPPPSPTRQVPP
Download sequence
Identical sequences I3KQS9
XP_013131860.1.78416 XP_019203000.1.78416 ENSONIP00000023474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]