SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023507 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023507
Domain Number 1 Region: 278-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-67
Family Extended AAA-ATPase domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 534-714
Classification Level Classification E-value
Superfamily FtsH protease domain-like 9.42e-61
Family FtsH protease domain-like 0.0000194
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023507
Domain Number - Region: 101-153
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.0837
Family Oxysterol-binding protein 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023507   Gene: ENSONIG00000018675   Transcript: ENSONIT00000023528
Sequence length 719
Comment pep:known_by_projection scaffold:Orenil1.0:GL831264.1:1543722:1551402:-1 gene:ENSONIG00000018675 transcript:ENSONIT00000023528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLSTTVQPQVTVPLSHLINVLHSLKSSVGSSSSASCKSRKHKERAADPELHCAESVWN
LRELGLSDLGTQQLDELVNRVLPHLSPQEAPLAFGGQTAWRTSHLSTHSFFHNKHGFSWS
RMPTPVFSRLHPSPLQSVCTDLQYWPALVQTRGFKTLRSKTRRLQSAFERPADSEGFTPS
FMKGFLTRDKGIEVESLDSVVKNKNIPDGQQDAFKRGFAEGFLKAQALTQRTQDSLRRTR
LILLVLLLVGLYGISKTPFISVRFRTTSGLDSAVDPVQMKNVTFEHVKGVEEAKNELQEV
VEFLKNPQKFTALGGKLPKGVLLVGPPGTGKTLLARAVAGEAEVPFYYASGSEFDEMFVG
VGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNE
GVIIIGATNFPEALDNALIRPGRFDMQVTVPKPDVKGRTEILNWYLKKIKVDPTIEANII
ARGTVGFSGADLENLVNQAALKAAVDGKDMVTMKELEFAKDKILMGPERRSAEIDDKNKR
ITAYHESGHAIVAFYTKDAMPINKATIMPRGPSLGHVSMLPENDRWSETRSQLLAQMDVS
MGGRVAEEIIFGHDYITTGASSDFDSATRIAKMMVTRYGMCEKLGIMTYTDLSAQSPETQ
AAVEQEIRVLLKESYERAKALLKSHAKEHKNLADALLMYETLDAKEIQLVLEGKTLETR
Download sequence
Identical sequences I3KQW2
XP_005458158.1.78416 ENSONIP00000023507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]