SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023554 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023554
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-30
Family G proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023554   Gene: ENSONIG00000018710   Transcript: ENSONIT00000023575
Sequence length 256
Comment pep:novel scaffold:Orenil1.0:GL831264.1:2014395:2015630:1 gene:ENSONIG00000018710 transcript:ENSONIT00000023575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITELNDEVRIVMVGKTGTGKSATGNAILGRGCFESKFSAVSMTVETSKGKATVDGHCVAV
IDTPGLFDTRFDEEKTQKNICQCISYASPGPHIFLVVVRLGRYTEEEKQTVQKIQKIFGA
DADKYSMVLFTHGDLLEGTTMEEFLEDSPDLQELVARCNGQYHVFNNKLKERSQVTELIQ
KIREIVQKNGGSHYTNEMFQKAERAIEEEKQRILREKEEEIRREMKKFKEKYERELKEEI
HKIQSTYKSKARDKSE
Download sequence
Identical sequences I3KR09
ENSONIP00000023554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]