SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023820 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023820
Domain Number 1 Region: 321-557
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.63e-32
Family Extended AAA-ATPase domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023820
Domain Number - Region: 21-29
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.023
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023820   Gene: ENSONIG00000018915   Transcript: ENSONIT00000023841
Sequence length 630
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:847244:854797:1 gene:ENSONIG00000018915 transcript:ENSONIT00000023841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFGLNKGQPEVPPGLPAQPPPPPPPPAGGSSGGGDKPKDKWSNFDPTGLERAAQAAK
ELDKSLKTQRALELARMQENTTQLEHQSKMKEYEAAVEQLKGDQIRIQAEERRKTVNEET
KQHQARAQYQDKLARQRYEDQLRQQQAMNEESLRKQEESVQKQEAMRKATIEHEMELRHK
NELLRIEAESKARAKVERENADIIREQIRLKAAEHRQTVLESIKTAGAVFGEGFRAFVSD
WDKVTATVAGLTLLAVGVYSARNATAVAGRYIEARLGKPSLVRETSRFTVAEAVKHPVKM
AKRLKSKPQDALEGVVLSPSLEERVRDIAIATRNTRQNNGLYRNILMYGPPGTGKTLFAK
KLAVHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWANTSRRGLLLFVDEADAFLRKRATE
KISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVNFALPGLEERER
LVRLYFDKYVLEPATGGRQRLKLAQFDYGKKCSEIAKRTEGMSGREISKLGVAWQAAAYS
SEDGVLTEAMIDARVDDAVKQHLQKMDWLRGEEAAKSLTPPPAGVTSSGGKMGFNLPLSE
TPHAQEVIAPVLEINEKMREDSPPKDGTPV
Download sequence
Identical sequences I3KRS5
ENSONIP00000023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]