SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023880 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023880
Domain Number 1 Region: 482-610
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-31
Family Bromodomain 0.00044
Further Details:      
 
Domain Number 2 Region: 175-285
Classification Level Classification E-value
Superfamily Bromodomain 8.37e-30
Family Bromodomain 0.00087
Further Details:      
 
Domain Number 3 Region: 27-161
Classification Level Classification E-value
Superfamily Bromodomain 1.13e-29
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 617-744
Classification Level Classification E-value
Superfamily Bromodomain 3.01e-29
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 5 Region: 364-469
Classification Level Classification E-value
Superfamily Bromodomain 3.01e-28
Family Bromodomain 0.00069
Further Details:      
 
Domain Number 6 Region: 1331-1399
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000327
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 797-859
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000746
Family Bromodomain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023880   Gene: ENSONIG00000018967   Transcript: ENSONIT00000023901
Sequence length 1604
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:1343720:1355123:1 gene:ENSONIG00000018967 transcript:ENSONIT00000023901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRRRATSPSSSVSGGDFDDSQASSLVPSFGRKRRRTSNIPTVDPIAVCHELYNTIRD
YKDDHGRMLCELFIRAPKRRNQPDYYHVVSQPIDMMKIQQKLKMEEYDDVEQLTSDFQLL
FNNAKTYYKSDSPEYRAACKLWDLYLRTKNEFVQRGEYDEDDEDGYDAQDNPSAPTCLKE
LLEQLLDAVVSYTEPTGRLVSELFQKLPSKMQYPDYYAIIKEPIDLKIIAQKIQLGHYRS
VGAMAKDIDLLVKNAKTYNEPGSQVFKDANTIKKIFAQKKSEMEHGEPIKSSIRIRYLTP
GIIFLSDFARNRRSAQGDRLSAITMALQYESDEEGILSGSVHYDEGESEAESMTSNMDMS
NPIFQLYEAVRGARNSQGQLISEPFLQLPSRKDYPDYYHQISQPICLHQIKNKMKNNEYE
SVEQIDSDLTLMFENAKRYNVPHSSIYKRALKLQHIQQMKRKELLQRDDDDGDSMLSSAT
SDTSSTKRKSHKKNTKKNRMKALFAAVTEAREAGTGRRLCDLFMVKPSKKDYPDYYKVIL
EPMDLRTIEHNIRSDKYLTEDSMLEDMKLMFRNARHYNEEGSQVYNDADVLEKIMKDKRK
ELGPATDDDDMMSPKLKIRKNSISLKKSKYLTPLQQKLHELYEAVKNYTDKRGRRLSTIF
LRLPSRAELPDYYIAIKKPVDMEKIRSHMLANKYQDVDALVEDLVLMFNNACTYNEPESL
IYRDALLLHRVLLETRRDQEGGEDAHVPDVPRLIQELIRSLFVSVLGHQDDEGRCYSDSL
AEIPAVDPANPEKPSLNFEIIRNNVDRGHYKRLDVFQDHMFEVLEKARRLNRTDSEIFED
AVELQQFFIRIRDELCKNGEILMSPALSYTSKHLHSDVEKEKKEKLPKEFEEDKIKREEE
KMEAEKREDPVGGSWQSGLQRTYSQDCSFKDSMYHVGDYVYVEPAEPNLQPHIIYIERLW
QDDTGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKAPVSKILGKCVVMFVKEYF
KLHPEGFRAEDVYVCESRYSAKSKSFKKIKMWTMPLSSVRFVPREVPLPVVRVASIFAQK
QEEKPPEIADESKITNGIIDKEREDVPLDVTNGEPGCQYYEQLCYNNLWLKVGDCVYIAS
HGLVPHRVGRIEKMWMRDGAGYFFGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTC
IIGKCVVSSFKDYLSCRPTEVPEENVLLCESRYIESEKQMKKFKGLKRFSLSGKVVEDEI
YYFRKLIVPQKEPSPLLDRKIEELEAKFADMTDEELEDLGDDDGELGDQTLPQMQSSMSS
DMDIMPYTPPQSTPKSIKGLSKKEGSKRKINMSGYILFSSEMRAVIKAQHPDFSFGELSR
LVGTEWRNLDSSRKAEYEEGRMGAYRSAMMPLQGHVEGMVSMTGIPPHHMGLPVFPQHLL
RVMPGFPGIPYFGKSAVIATPPVNNGVGGPGAGSVHGSQMGLVGPGQQAPPPYPGQAQIG
QPALQQPSTPVFVSPPAKNQRVLHSEAYLRYIEGLTAESPTVSKWDQALSVQKQDVRLTK
EQESRLPSHWLKSKGAHKTMADALWRLRDLMLRDTLNIRQMHNL
Download sequence
Identical sequences I3KRY5
ENSONIP00000023880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]