SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023941 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023941
Domain Number 1 Region: 32-61,180-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.61e-63
Family G proteins 0.0000000344
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.66e-41
Family Transducin (alpha subunit), insertion domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023941   Gene: ENSONIG00000019015   Transcript: ENSONIT00000023962
Sequence length 355
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:1833874:1885680:1 gene:ENSONIG00000019015 transcript:ENSONIT00000023962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTVSQEDKLAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECRQYRAVVYSNTIQSIMAIIKAMANLKVDYEESARADDARQLFALSGAAEEQGTL
PEDLSNIIQRLWADGGVQSCFTRAREYQLNDSAAYYLNDLERIAKPDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFQEKIAHSPLTICFPEYTGPNTYEEA
QGYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences I3KS45
ENSONIP00000023941 XP_003441497.1.78416 ENSONIP00000023941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]