SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023962 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023962
Domain Number 1 Region: 260-468
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 7.86e-61
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 47-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-41
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain 0.0000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023962   Gene: ENSONIG00000019031   Transcript: ENSONIT00000023983
Sequence length 477
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:2118165:2126214:1 gene:ENSONIG00000019031 transcript:ENSONIT00000023983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRMIDNQEFMVEAYPRELTQNPLRKIWMPCKNGHIVHRRVCMTNCPTLIVTVGLPARGK
TYISKKLTRYLNWIGVPTKEFNVGQYRRECLKIYKSFEFFRPDNEEGLKIRRQCALSALN
DVRQYLSVEGGQVAVFDATNTTRDRRKTIIMFAEQNGYRVFFVESVCEDPEVIAQNIVQV
KLGNPDYIDCNSDEAIKDFMKRIKCYESSYQPLDEVLDRDLSYIKIMDVGRRYLVNRVVD
HVQSRIVYYLMNIHITPRSIYLCRHGESDLNIKGRIGGDSGLSDRGKEFAKRLRNFLQEQ
NIKNLKVWTSQMKRTIQTAEILGVSYEQWKSLNEIDAGVCEEMMYEEIQERYPLEFALRD
QDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKTADELPY
LKCPLHTVLKLTPVAYGCEVESFCLSVDAVNTQRDRPENVNVQRSTEDALQTVPAHF
Download sequence
Identical sequences I3KS66
ENSONIP00000023962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]