SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023987 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023987
Domain Number 1 Region: 13-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-60
Family Ankyrin repeat 0.0000735
Further Details:      
 
Domain Number 2 Region: 470-519
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000916
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023987   Gene: ENSONIG00000019053   Transcript: ENSONIT00000024008
Sequence length 525
Comment pep:known_by_projection scaffold:Orenil1.0:GL831209.1:98349:103622:-1 gene:ENSONIG00000019053 transcript:ENSONIT00000024008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFTECYRDTVSSVATAARSGCRRRLRTLIQRGCSVDCRDNRGWTPLHEAAAAGSKACVQ
EILSAVRARSSSCSRVYVNHLTHEGESACYLAAQRGHLSVVRLLLKAHADINQLTNDLSC
PLYEAVSHGHTDVVELLVSKGAEVNRIHTESSWTCLHQAAYKGHTEIVRILVNKCNLEAV
DDYRISPLFVAAQYGQRGCLEILVNAGANVNTQAVDLSTPLFIASQEGHQACVDFLLDHG
ADPNMVCSHDWPQFAIHAAAQFGHIGILRSLIAVTDRACDRGESMVSPVYVAVNSDQPKS
VELLLREGYSPDAQDCSHTHGLLSPLSLALYRTPQKPYRCFDIKISFSELVKLLIAAGAR
LNEEDWIYALATDEADLLQLIFEHRWIPRPEELNEMLCVALSQVHFAGCWLPLLLKAGLE
PSLLLQPHMLEQADSQVLNYLLEFVNWSTLSPHLKHILDRKVAEKSWDPHPCFDSVPCLS
HICRLQVRALLGPDILMRTNVVQQLPVPNRLHDFLKFRDIPEASY
Download sequence
Identical sequences I3KS91
ENSONIP00000023987 ENSONIP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]