SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024149 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024149
Domain Number 1 Region: 790-967
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-51
Family SPRY domain 0.00051
Further Details:      
 
Domain Number 2 Region: 522-777
Classification Level Classification E-value
Superfamily RNI-like 4.81e-46
Family 28-residue LRR 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000024149
Domain Number - Region: 98-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000606
Family Phosphoribulokinase/pantothenate kinase 0.088
Further Details:      
 
Domain Number - Region: 15-64
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00126
Family G proteins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024149   Gene: ENSONIG00000019185   Transcript: ENSONIT00000024170
Sequence length 968
Comment pep:novel scaffold:Orenil1.0:GL831162.1:357695:368721:-1 gene:ENSONIG00000019185 transcript:ENSONIT00000024170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQEQVQDYASNFIFVTNKLKFNLKEKFQRVFEGIAKAGKTTLLNQIYTELYITEGWTAE
VNKEHEVRMIETVSAKPDRPETTIRQEDIFKASPERNKPIRTVLTKGVAGIGKTLLTQKF
SLDWAEEKANQDIQFIFPFTFRELNVLKEERFSLVELVHHFFTETEEAGICSFQDFQIVF
IFDGLDECRLPLDFHKTKMLSDPRRSTSVDVLLVNLIRGKLLPSARLWITTRPAAADQIP
PQCVNIVTEVRGFTDPQKEEYFRKRFRDEEQASRIISHIKTSRSLHIMCHIPVFCWITAT
VLEDVLQTREKGTLPKTLTEMYIHFLVVQAKVKKVKYDGGAETDPHWSRESRKMIETLGK
VAFDQLQKGNLIFYESDLTECGIDIRAASVYSGVFTQIFKEERGLYQDKVFCFVHLSVQE
FLAALHLHGTFINSGVNLLEKQQTTSLFSKLFKKPKSAVDKALQSPNGHLDLVLRFLLGL
SLQTNQSFLRGLVTQTGSSSQTNQETVKYIKEKFSENLSAEKSINLFHCLNELNDRSLVE
EIQQSLSSGRLSTDKLSPAQWSALVFILLSSEKDLDVFDLKKFSASEEALLRLLPVIKAS
NKALLSGCFLSERSCEAVSSVLSSQSCSLKELDMSNNNLQDSGVKLMSAALQSPHCNLKT
LRLTCCFLSEKSCEALSLVLSSPLCSLRELDLSDNDVQDSGLKLLSGVLQSPHCTLETLS
LSGCLITEEGCTSLASALSFNPSHLRKLDLSYNHPGASGIKLLSIGLEDPHWRLDTLRYG
HGNPSRLIRPTRKYSCQVTIDTNTVNANLKLSDNNRKVTHVEEVQSYPDHPDRFDFWPQL
LCRNGLTGRCYWEVEWKGKSYISVSYRRIRRKGDSNDCVFGNNDHSWSLSCYNGAPRSLW
HNNRSTSISSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFNTTFTEPLYPGFWFN
SGSSVCLC
Download sequence
Identical sequences I3KSQ3
ENSONIP00000024149 ENSONIP00000024149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]