SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024266 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024266
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.22e-43
Family Nucleotide and nucleoside kinases 0.000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024266   Gene: ENSONIG00000019281   Transcript: ENSONIT00000024287
Sequence length 216
Comment pep:known_by_projection scaffold:Orenil1.0:GL831162.1:3942718:3946641:-1 gene:ENSONIG00000019281 transcript:ENSONIT00000024287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKRGALIVLEGVDRAGKTTQCSKLVQALQQSGRPAEMMRFPDRTTTIGQLIGAYLENK
SDLEDHTVHLLFSANRWEMVPLMKKKLEQGITLVVDRYAFSGVAFTSAKPGFRLDWCMQP
DVGLPKPDLVMFLQLNPAEAALRGQFGQERYETSVFQRTVQQRFEQLMKDQTVNWQVIDA
AQNIENVHRDITAHSLNAINKAQNLPLGELWSETPK
Download sequence
Identical sequences I3KT20
ENSONIP00000024266 ENSONIP00000024266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]