SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024308 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024308
Domain Number 1 Region: 37-782
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-275
Family Motor proteins 0.0000000000954
Further Details:      
 
Domain Number 2 Region: 2070-2160
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-21
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 3 Region: 1953-2069
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-20
Family Second domain of FERM 0.0051
Further Details:      
 
Domain Number 4 Region: 1251-1354
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-17
Family First domain of FERM 0.067
Further Details:      
 
Domain Number 5 Region: 1856-1961
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000913
Family GABARAP-like 0.074
Further Details:      
 
Domain Number 6 Region: 1346-1439
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000236
Family Second domain of FERM 0.013
Further Details:      
 
Domain Number 7 Region: 1581-1641
Classification Level Classification E-value
Superfamily SH3-domain 0.000000042
Family SH3-domain 0.003
Further Details:      
 
Domain Number 8 Region: 787-853
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000871
Family Motor proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024308   Gene: ENSONIG00000019314   Transcript: ENSONIT00000024329
Sequence length 2173
Comment pep:known_by_projection scaffold:Orenil1.0:GL831162.1:4369195:4393285:1 gene:ENSONIG00000019314 transcript:ENSONIT00000024329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQGDFVWVDTGTGVPIGAEVKVTDTGQIQLIDDEGKEHKLKKTNEKSIRPMHPTSVKGVD
DMIRLGDLNEAGLLRNLLVRHKEGIIYTYTGSILVAVNPYQLLPIYTIEQVHMYTDRRLG
ELPPHVFAIADSCFFNMRRNRKNQCCVISGESGAGKTESTKLMLQFLAAVSGQRSWIEQQ
VLEANPILEAFGNAKTIRNDNSSRFGKYIDINFTKGGAIEGARIEQYLLEKSRVCRQAPD
ERNYHIFYYMLMGMSAEKKKILSLGNAVEYKYLTMGNCTSCEGRDDVKEYAHFQSALKIL
TFTENDLWEISKLLAAILHLGNVDFEATIVENLEACSVHTSTNFKMASELLEVDPKALGK
GLTQRSFQTAREHVTKSLTTAQAMDGRDAFVKGIYGRLFIWVVEKINSAIYKPPDEENEA
KQSIGLLDIFGFENFSKNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWKHIDY
QDNQRTLDVLASKSMNLLSLIDEESNFPKGTDATLLQKMNQFHEKGGIYLPPKNNYETQF
GIEHFAGKVFYDSQGFLEKNRDTLSSDLIKMLEKSTNKLLKQAFRKELNSTSDGKKRVPT
LSGQFRQSLDSLMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRK
AGYPVRYTFDEFLTRYRVLLRTSICDPKTESEEKCCESICENMLTGEGDWKTGKTKIFLK
DHHDTMLEVERIKQLNLKALLIQKVLRGYKYRKEFLRKRSAATVIQKYWRGHKGRKLYKV
VQLGFARLQAQVRSRQLHFRYKKRRQATLVLQAHIRGHLARKEWKRKRKAVILLQAHTRG
ILARKALEKMKRDIYLIMLEHHFEYLFLALVYSIHKSIYLYGFVKALFLLFQMYLSAKEK
EEEQRLILEKQRRLEEVLRQKREMEAKQQSDQEMVDDMFDFLTLMPNTVGGQEGQAPVGF
ENLGGKRIIEEIDIDEIQLEEDLPNEDYDDLDEYSFAKFASMYFQGAATHTHIRQRLRQP
LLYHEDEDDVLASLTVWWIILRFMGDLPEPKKRAQELMSRKDRRLSNMVGLDQVGIKTLK
TECLQQSLTSESSSNLFSFIKKATKKPSIIMEESDDQTEVSKPTTLQTVKEDPEVLTGES
DTLDRPLTSLEKLHYIVGYAIVRPDLRDEIYCQICKQLHDNNIRTSFFRGWILLSLCLGV
FPPSERFIRYLQSFIRSAPSGYSSYCADRLRRTVMNGTREEPPSYLELQATKTKKPIVVT
VMLMDNRSINLPVDSASTSKEICQLISNKINLKDSFGFSIYVALYEKVWALGSGREHVMD
AISRCEQDTKRRGGQEQHAPWRLIFRKEIFTPWHNCSDDKLSTDLIYKQIIHGLKSGEYQ
CQKEDDYVDLAAKHLYIQHGSDSRPENVKDVVQDCISNSLLETKTETKWVQMVSTAHAQG
SYVSSKQKPDSLKAEIVDYARQKWPIFFSRFFEVAKLSGPPLPKSKFIVAINWTGITFLD
EREKRLAELSFPEVMAVNTVRNVKKSGQAVSLVTLKGDFTLSGPSAADMAELITMFVSGL
TERSQYAVALKEAEKQVFQSSPEDATFLSFKKGELIMLIKDNDFSQDHGWVKGQNDRTKQ
TGAVPLDAITILPTLSKPTKEVMNLINLSPNQRKDIIQATMKETGTVGRMAPYSLKDFSV
EYFRQPTKDVNRQVIARNAAPERLWVHSREPIRQPLLKKLGGHPEFTHKACLAFTAILKY
MGDYPTKQQQSPLELTDQIFSPATKHDALRDEIYCQIMKQMTTNNNRPRFSMEHGWQLMW
LCCGLFPPSQPLLKHAQRFLESRRREPLASDCLQRMQSSLRMEPRKLPPHHVELDAIQQN
STQIRHKIHFPNDTDEIFEVATNTRIKDLILNISRKLELSSADGFSIFVKTNDKFLSLNE
TDYFFDSLRQITDWSKSVKRIDGGLVNYTVFFMRKLWFNVIPGRDTKADLIFHFPQELPK
YLRGYHVCTKEEMLKIAALLFCIKVNNDKNQLVMIPKLLKELVPTDQLKAMSENEWKKHI
TASFNKQTGMTADEAKVAFLKAVHRWPTFGCAFFDVKQTSEQKFPDIVRIAISKQGLTII
HPKTKETLATHPFNRIANWSSGSTYFHMTIGNLVNGSKFLCETSLGYKMDDLISSYVNMY
LSDRKTVQTRNRR
Download sequence
Identical sequences I3KT62
ENSONIP00000024308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]