SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024337 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024337
Domain Number 1 Region: 135-214,242-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-30
Family G proteins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024337   Gene: ENSONIG00000019335   Transcript: ENSONIT00000024358
Sequence length 556
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:5036091:5040817:-1 gene:ENSONIG00000019335 transcript:ENSONIT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPKLKKASKRLSCAKRYKIQKKVREHNRKLRKEAKKKGVSKRVKKDIGVPNSAPFKEE
ILREAEQRRLQIEEEKEKRRQAKKEQRAEKRKKEKEAASKEAEPTAKKARKDDSGTQSEK
KPAPDRSSKHFLCAELNKVIDASDVVIEVLDARDPLGCRCPQLEEAVLQRGGTKKLLLVL
NKIDLVPKENVERWIQCLQQEFPVVAFKASTQLRDGVVKAKKRRIVASNEVLDRSRGAAC
FGNCCLAELLIGYADKTQNEGSLRVGVVGFPNVGKSSIINSIKGSLACNVGIKRGTTKMM
QEVHIAKNVKLIDGPGVVASPSNPPASMALRSLQVEEGGESVLEAVRNLLKQCDKTQIML
QYNVPDFRNSLEFLTLFAKKRGFLQKGGVPNTEQAATTFLADWTGAKLSYHCKAPENHSL
PAYLSDAVVTEMKNGWNLNKIKTGNKETLKAVRFPNQASSIGFTSKGPTSGLLSVSDIPE
GKPGAAATEEEAEQNDESSETEQTTEDSNTTEKAEKLQKKTIKKKKGNVRFQSVPIDISL
STAITDDTYDFNTDFQ
Download sequence
Identical sequences I3KT91
ENSONIP00000024337 XP_005469388.1.78416 ENSONIP00000024337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]