SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024434 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024434
Domain Number 1 Region: 54-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000503
Family G proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024434   Gene: ENSONIG00000019412   Transcript: ENSONIT00000024455
Sequence length 451
Comment pep:known_by_projection scaffold:Orenil1.0:GL831278.1:363967:372130:1 gene:ENSONIG00000019412 transcript:ENSONIT00000024455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKIKSRSAANSDSITGGVSCDERILRDCHQLYTDPDSGLIPVAESVGVKLLPPRKKIT
VLLMGNHSAGKSSFINWYVEEHIQRTGVAIETQGFSFVTSGRKRESLTGNATLHLYPHFK
PLQEFKGVSEYLSTEICTSRQKRFSLVTFVDSPGLVDGDMKYPFDVDEVILWLGDLCDLI
LVFFDPMGQALCKRTLNIVESLNEKHGDRLRFYLSKADEAGGESDRQRVMMQIVQELCKR
PGLNKCGFDMPTIYIPNPNKPSRCINQIEEVCRTIEKTINQTVQNTLNSLERDCELIVEA
VTDKLINDRQTTVENRRARCKSCFLTLLGFSVPLALMAFLLLGVLSQDLLDAALGQEGTE
ALSLYLMPAVKIFQSLSVEQQLYGCAGLVLLSFLLLIIARFTFRTQPTLSTKQKRQLQEK
LEYVQEVVKTKKKKLYEDYLRQSVSDHDMGL
Download sequence
Identical sequences I3KTI8
ENSONIP00000024434 ENSONIP00000024434 XP_003454036.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]