SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024651 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024651
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.15e-86
Family PAPS sulfotransferase 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024651   Gene: ENSONIG00000019581   Transcript: ENSONIT00000024672
Sequence length 288
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:1821837:1829240:-1 gene:ENSONIG00000019581 transcript:ENSONIT00000024672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETELYTLYKGVYVPSSLHPPESLRYYEEFTFRPDDILIVTYPKSVGTTWMQEILPLII
SGGDPASVETLHNWDRVPWLEENRALTLNLEKRPSPRMFTTHFHYSMMPPSFFEVKPKVI
YIMRNPKDVFTSAFHYFGSTSFLVKPGPQSEFLQKFLDGEVIFGSWFDHVKGWLNAKDKG
SIMYISYEELLKNLKDSVTRIAQFMEKSLDTEVIEKIAERCLFKNMKKNSMSNYSAVPKE
FMDQSKSEFLRKGIAGDWKNQLTEAEAEYFDAVYKDKMKDVKYKFVWD
Download sequence
Identical sequences I3KU55
ENSONIP00000024651 ENSONIP00000024651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]