SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024682 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024682
Domain Number 1 Region: 320-448
Classification Level Classification E-value
Superfamily Plus3-like 4.84e-46
Family Plus3 0.000000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024682   Gene: ENSONIG00000019605   Transcript: ENSONIT00000024703
Sequence length 677
Comment pep:known_by_projection scaffold:Orenil1.0:GL831171.1:4343314:4358159:1 gene:ENSONIG00000019605 transcript:ENSONIT00000024703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNVKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRVDSGEQEEPVGKPAASTDSETS
DSDDEWTVGGTKGKKKVKQGKGSEKKNATKKKVNKATASGSSDGDSSAESSAPEEGEVSD
SESNSSSSSSDSDSSEDEVFRDGYDDDLMGDAEDRARLEQMTEKEREQELFNRIEKREVL
KRRFEIKKKLKTAKKKEKEEKKKKQEEEQEKRKASQVQDTQVVMSHNKERRSKRDEKLDK
KSQAMEELKAEREKKKNKTAELLAKRQPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSS
SYDEDEKEETPPKSQPVSLPDELNRIRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSS
KPVYRVAEIVDVVETAKVYQLGSTRTNKGLQLRHGGDTRVFRLEFVSNQEFTESEFMKWK
EAMIAAGMQVPTLDEITKKEQSIKEALNYKFNDKDIEDIVKEKDRFRKAPPNYAMKKTQL
LKDKAMAEESGDGERVKVIQDELNELEERAEALDRQRTKNISAISYINQRNRSWNIVESE
KALVAEGQNAKNQQMDPFTRRQCKPTMVSNARDPSVHAAILAHLNQKYGSGSTPDNSSPE
KNKLGQTNQKDKDVPKPTTDLSEDLFKVHDFDVKIDLQVPNAEAKSLSVSSNALPVKDGA
PRRSLNLEDYKKRRGLI
Download sequence
Identical sequences I3KU86
XP_003445517.1.78416 XP_013126929.1.78416 ENSONIP00000024682 ENSONIP00000024682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]