SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024719 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024719
Domain Number 1 Region: 54-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.88e-59
Family G proteins 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024719   Gene: ENSONIG00000019635   Transcript: ENSONIT00000024740
Sequence length 250
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:3197816:3311625:1 gene:ENSONIG00000019635 transcript:ENSONIT00000024740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKKTAKGKGSSKSPKASPSSGRTGKGLTAAAAPSSGLVYPSRPSISNSGEFYDIAFKV
MLVGDSGVGKTCLLVRFKDGAFLAGSFISTVGIDFRNKVMSIDAVKVKLQIWDTAGQERF
RSVTHAYYRDAHALLLLYDVTNKASFDNIRAWLTEIHEYAQQDVVVMLLGNKADVTHDRV
VKREEGEKLAKEFGVPFMETSAKSGLNVELAFTAVARELKHRTMKEPDEPKFQLQEYVDK
EMRTAGCCRS
Download sequence
Identical sequences I3KUC3
XP_003438725.1.78416 ENSONIP00000024719 ENSONIP00000024719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]