SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024797 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024797
Domain Number 1 Region: 543-627
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.57e-36
Family Kix domain of CBP (creb binding protein) 0.00000607
Further Details:      
 
Domain Number 2 Region: 1027-1143
Classification Level Classification E-value
Superfamily Bromodomain 7.72e-34
Family Bromodomain 0.000000676
Further Details:      
 
Domain Number 3 Region: 298-390
Classification Level Classification E-value
Superfamily TAZ domain 1.1e-28
Family TAZ domain 0.00000137
Further Details:      
 
Domain Number 4 Region: 1711-1795
Classification Level Classification E-value
Superfamily TAZ domain 4.45e-24
Family TAZ domain 0.00000215
Further Details:      
 
Domain Number 5 Region: 2027-2083
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.28e-23
Family Nuclear receptor coactivator interlocking domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1647-1693
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000553
Family ZZ domain 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000024797
Domain Number - Region: 1223-1264
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00417
Family PHD domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024797   Gene: ENSONIG00000019702   Transcript: ENSONIT00000024818
Sequence length 2395
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:4963736:4988045:1 gene:ENSONIG00000019702 transcript:ENSONIT00000024818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENVLDSGPPSAKRPKLSSPALSASASDGNDFGSLFELEHDLPDELISSNEPGLVNGGD
PNQDAVAKHKQLSELLRAGATPSTQPGHQGAMGSPGGPAAMGQHLANMKASPGQGPQQMM
GQGQHLSSQQQANMMQQQSAAGGMIRTMMGAQQKGSNGQQQPGMIGNQVMNGSPRMGFGN
QGMAGGSNLLAETLQQPGAGGQAGIRGQQPGAMNKMGMMGNPGGPFGGPYGSQGNQGLGG
TGLGPQLQNKGPMANSMAQFNVDKKNQPMQGMSAMGTQQSQTGVGGPTASAAAGAPPTAD
PEKRKLIQQQLVLLLHAHKCQRREQANGEVWQCNLPHCRTMKNVLNHMTHCQAGKSCQVA
HCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNTQSLLAGAATGLGSSLGTVPGSQPSA
PNLNQPSQIDPSSIERAYAALGLTYQGNQIQAQTSQPNMPNQGLQGQAGVRPLNPLGGVG
VNPMGVNGGVGASPQSQQASLLQDTMMHLNMNSQGIHSVSSSLNDAGGVGSMPTAAPPSA
TGMRKNWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESAN
SRAEYYHLLAEKIYKIQKELEEKRRTRLQKQGVNIGSAGMGQPPTGLPPNGPLTDPAMVR
PAGPNQMNRMQSPGMNQFNQMGIQSMGQRSTPPLPLGASGNQVSTHSVSGQFPGSGPGVG
AVQSGMTPPGGPGGMVQTQMGTPPPLSVASPLAQLGSAGTPSGVPAVGPMGPQSVGGGGP
NSAVGAPASSMTPSNTNQQPNSNPHLGAMRGSSPSPAHSRSPTPHQTPPRLAGSQTPQPH
TPNASHLVPPPTPQQNQLGQGPGSNKPLQQQHMGPAGSTTPSHPGMASSSTPHGSQLPRT
PLSQKGSFPADSQAPTPASVSSLDTSSQQPASDTSANNVDMKMEVKHQDEEDESDAGSCS
KGGKLGNLKMEEKPVKSELKKEETSTTTQVSGVKTEDRKPEIKKEVKKEVKDEEETSEAV
VSQAPVKKKIFKPEELRQALMPTLESLYRQDPESLPFRMPVDPQLLCIPDYFDIVKNPMD
LSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQ
SLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNRYHYCEKCFNEIQGETVSLGDD
PTQPQTSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPEGFVCDGCLKK
SNKTRKENKYSAKRLPQTKLGVFLEQRVNDFLKRQANPESGEVFIRVVHVSDKVVEVKPG
MKSRFVDSGEMSESFPYRTKALFAFEDIDGADVCFFGMHVQEYGSDCPQPNQRRVYISYL
DSVHFFRPRSLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPADQKIP
KPKRLQEWYKKMLDKAVAERIVHDYKKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESI
KELEQEEEERKREENSTSNESVDDTKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPNV
SNDLSQKLYATMEKHKEVFFVIRLIAGPMANALPPIADPDPLMACDLMDGRDAFLTLARD
KHLEFSSLRRSMWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCY
NTKGHEHKMEKLGLGLDDESSNQSAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLP
SCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQ
QLQHRLQQAQMLRRRMASMQRVGQPAAGGAPGGNGQPSPGANNGATGPGTPTSGTQPPTP
QTPTQGNMSAPSQQQGVGMGGMGTPDNPRPAGVPPLHQPLGKPGMGPATPPLQQPPPNQG
QGSMGVQGQQQGRMQQGGPSSQLPPQVQQQVQPGGQLQPTNQQWGAGGPTMNQQQRQNMM
GHMTPQPAVPQPQQQMLNQQQPQPGNRGLMQAIGGAGGVPASLAAGSGNLPQAALQDLLR
ALRSPSSISQQQQVLNILRSNPTLMAAFIRQRAARYQGAQGGPGGAGGPPQGGPGGVRFQ
GAAGGLPGVGAPGANQLANMDGQQQGGMQPGQQGNMANMTPQFREMFLRRLQQQQQMGNH
GQFQQPQGLQQQQQGQQSFMQPGQGQPGITPSSQPQPGGGHRVMQQQQQQNQMGGLQGQD
VGPSGGPGGPPLQPGQGGGPPMPQTSQAMLAQNIQQRLLQQQQQQHLGGGSPAHHSSPMS
PQQQMAQSPHHHLQGQGGLGPAGSLSSQVRSPQPSPRPQSQPPRSSPSPRMQPSSQPQPS
PHRISPQTQSGSPHPGHLSQHYSNMAPPQPPQPQQQQPDPSQYNSDQNSIMSQLS
Download sequence
Identical sequences I3KUK1
ENSONIP00000024797 ENSONIP00000024797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]