SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025187 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025187
Domain Number 1 Region: 630-984
Classification Level Classification E-value
Superfamily RNI-like 7.07e-64
Family 28-residue LRR 0.0073
Further Details:      
 
Domain Number 2 Region: 918-1120
Classification Level Classification E-value
Superfamily RNI-like 8.63e-47
Family 28-residue LRR 0.01
Further Details:      
 
Domain Number 3 Region: 192-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000317
Family Nucleotide and nucleoside kinases 0.058
Further Details:      
 
Domain Number 4 Region: 39-120
Classification Level Classification E-value
Superfamily DEATH domain 0.0000259
Family Caspase recruitment domain, CARD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025187   Gene: ENSONIG00000020002   Transcript: ENSONIT00000025208
Sequence length 1130
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:8204963:8222882:-1 gene:ENSONIG00000020002 transcript:ENSONIT00000025208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTHYDSILDRSKRITWQDDCYVDLQSTTSSQAETEDLGWIQKHQDQLQSFITPSFLGE
ILNHMRNLDVLSSAQEIKVKEAGRLQDQINMLTTIVTAKDSQGSDVLQGFIESSDSQVAQ
LIINHDAMVKEHKEVLLRRYEQYRDRDSISCPRLNISSRTLLLVDGLSDLQQKEHDLMQV
GVTRGEKRNHLRQLGLAKLFEPLTRVSMPPRVSLTVGVAGIGKTTWVRHFVRQWCQGIIC
TDINFVLPFTFAELNLLDKLSAERLVKMAFPHISDPSLVLNSSCRTLLILDGLDEFRCKL
NFSDAAPCSDPKKEVPIDDLVTNIIRGNLLPDIAVWVTSRPRVASLIPGGLVDRVTEIPG
FSPKDIEIFLNHHFSEKDFARKIWSHLESNKILMVMCYIPCICWIVADTLLYIMQNEAQE
TLPRTCTELYANFCSMKAELGEPRGREPVKMEQLHGSNRKLLGNLGRLAFYGLLKHKYVF
SEQDLKNYGIELLVTQSSLGSGVLVREESTINTTYRFTHLTLQEFLAATFYHVSSKRAIF
DLFSESSMSWPKIGFQNHFRSAFQHSQQAEDGHLDVFVRFLTGLLCSAAIKPLAGLLALG
KDDGNNKTWAAGFLQGLLVSGGAVVSLRAVNLAYCLQELQHTEMLRSVEEDLRLGSLAGK
LTRPHCVVLGYLLHVSPECSEQTNLTASLNASTVKCLLPQLLYCSHLRLENNHFKDDVME
LLGSLLSAKDCHIQKISLADNAISNKGAKALSRALLVNRTLTSLNLRNNNIGSKGAKFLA
EALKMNQVLTSINFQNNAIEEEGAQSLAEVLQCNRKLVSLNLRKNTIAAGGAKRIAEALK
TNRTLTKLILCGNQLGDKGTVALAEALAVNHTLLSLHLQSNSISNKGMTALTKALRLNHG
LVSLNLRENSIGVEGAKNMAHALHENNTLQDLDLTANLLHDDGIQAIAGAIKFNRGLTSL
HLQWNFIKSTATKALAHALLSNSTMQLLDLQENAIGNEGVTFLAEALKTNASLRTLCLQG
VSAGTSGAIKMAEALMTNQTLQTLDLRGNTVGMEGAKALANALKSNRSLKSLNLQENSLG
MDGAIFIATALKGNHQLTYINLQGNGIGESGAKVISDAIRASASGCVVDI
Download sequence
Identical sequences I3KVP1
XP_003438651.1.78416 ENSONIP00000025187 ENSONIP00000025187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]