SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025356 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025356
Domain Number 1 Region: 22-390
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-118
Family Motor proteins 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025356   Gene: ENSONIG00000020128   Transcript: ENSONIT00000025377
Sequence length 1389
Comment pep:known_by_projection scaffold:Orenil1.0:GL831260.1:704375:714654:-1 gene:ENSONIG00000020128 transcript:ENSONIT00000025377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSGKGSADSTHLAASSESDSIKVFVRVRPLTRDTGLTTDGDQKLCLSVTSPNTIRLLS
KPEPRTFTYDHVADMDTTQDAVFSSVAKNIVESCMNGYNGTIFAYGQTGSGKTFTMLGPS
ELDNFTDDLRGVIPRSFEYLFFLINREVERSSQSKSFLCKCSFIEIYNEQIYDLLDTASA
SLFLRENIKKGVFVEGVVEKFVNSAAEAYQVLSMGWRNRRVASTSMNRESSRSHAVFTMT
LESKESINEVVNIRMSQLNLVDLAGSERQKDTHTEGSRLKEASSINRSLMCLGQVIMALV
DVSNGKNRHICYRDSKLTFLLRDSLGGNAKTYIIANVHPGSKCFGETLSTLQFAQRAKLI
KNKAVINEDTQGNVKQLQAEVKKLKEQLAQALTSQGVDYGRDVAPGGPELHMANPGSSIE
THHDVSYKAKFMSAVRLWKKQDEEKKALLTKVAQLEEAWAQKDKFIHSSRMIVRFREDHI
SRLEKKLKAGENSLSDKDSQALIDQLKEEIKILKDQVEHHPKMTRYAAENYSLREENRQL
RSLESVVKAQEVAAQVAVEIEEAFQKAVESERPTETSEVSSASVATDTTSAATIEKLNAK
LLQKQSDLTGALQAFEEYKDVTKKQMAQLESEKRYLEKSNKHLEKILEATNAYNKQEVSE
LNRIHVETLKILSTPTRGYNLRSRLVPLSSPEHLNGTDNNEDGIWSEQPPSDMTEMALTE
ELRQVQDQASRIQAQLNEEELKNSKLLQEIAKLEEQVAVITQETDHKDEQLSTERNNWNK
DQLGLQETINNLQQSLQSEQQAAEVLRSEIRDLRLVLQSSDKELASVKNKLIDSQSEQQR
EMSQLSNSLISTQLQLDKVQLEWEQLLEQHRTLQDSFDQLQAEAKFEADQSRQQLDDRQK
EIDELKAEIMKLNNSLQTEQAHTNTLVSQLKENKESTSKELLETVEQNTQLKKQVSDLIT
QNQQQASTLADLEQNLTSAKESIKSLEQKTEQDKDVVLDLINQTRDLRSELSQKDQTIVH
LTEDIRDLTAKCNAACCERDNIKEQNCKMQEEICDLKETLDRRVASNKIEVEVLQEEIVY
ATEEVERLTKVLDEQNSLLQASQAQTAKKDVIIQNLQQKLQRQQEAVEKTIRNGAFQPPV
EPTVTPKSFPRTPRTPGSFNRDLSQVLEIQERELENRRSSMMTMEILLSELNAERAAKNE
EIERLKTQLSEKEMVRMEIQALLDKFYTKQNQMTQNGNNNGEELNEAFKHSILKELDEER
AEKSKMMQKLSETQKKLQAQESMLVQSQTCIQELTTELRNRCLELRETNQRVVEEEKFIQ
EIEVLRKQNIKLSEENGKLVGHKNHKQRIEYLVKLKKDNTKLQEENEKLRTEISLMRENT
GCPPLEINL
Download sequence
Identical sequences I3KW60
ENSONIP00000025356 XP_005477080.1.78416 ENSONIP00000025356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]