SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025379 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025379
Domain Number 1 Region: 385-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-60
Family Tandem AAA-ATPase domain 0.0015
Further Details:      
 
Domain Number 2 Region: 220-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000213
Family Tandem AAA-ATPase domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025379   Gene: ENSONIG00000020143   Transcript: ENSONIT00000025400
Sequence length 855
Comment pep:known_by_projection scaffold:Orenil1.0:GL831260.1:976060:981071:-1 gene:ENSONIG00000020143 transcript:ENSONIT00000025400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKKMKAKNKGMSTGLGKPAKRCIDMKGKWKTIDLDPSVFSEEGLEGLVCFEELTDYRL
INSEQAAAKAAKELKREKKKKAQKRKAGDGEEAGEKGDSGIKEGESTSEPAKKKAKKKRK
NKKGIAKESENISAEDVKQKDNAATEQGGEDEVSGEGDENDSAAITADPKDTKRSRKKKK
KGKDLEKEKSGQNKVTKAPHKKAKNWTNAALSGSEDKNVDMSAWKDLFVPPPVLRALSSL
GFGSPTPIQALCLPPAIRDRMDILGAAETGSGKTLAFGIPIIHTILEWKHSPEKPNDDAE
PVTKVESLYLPSVDEYTKSAEEDQEEGVEASKENDEDAEDQNQGDSDEDEHSDVEDEQLG
CVRVIKNADFDFDEKPAGAQSRPLLGLVLTPTRELAVQVKHHIDAVAKFTDIKTALVVGG
MAQQKQRRVLKRRPEIIIATPGRLWDLIKERHPHLVNLRQLRCLVIDEADRMVERGHFAE
LENLLEMLNTTHFNPTRQTFVFSATLTMVHSLPTRLLQKKKKNLDQRNKLEILMEKVGIK
SKPKVVDLTRKEATVETLIETQIHCQKDEKDFYLYYFLLQYPGRTMVFANSIDCIKRLNS
LLVILDCTPLPLHANMHQKQRLKNLERFAERENCVLLTTDVAARGLDIPNVQHVIHYQVP
RTSETYVHRSGRTARATKEGLCMLLVSPDDMMNFKKICKTLGKDEELPTFPIETKCMDAI
MERVNLARRIEKVEYYNSKEKHHNSWLKQAAEALEVDLDDDLLLGNAKDEDADREQQRMV
KGMKKELKRLISLPIFKNVMKTKYPTQMGKLPLPQMPLAGMESALTRVSTQKKPKTSIHP
RQKKQKQKANNTNTN
Download sequence
Identical sequences I3KW83
ENSONIP00000025379 ENSONIP00000025379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]