SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025507 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000025507
Domain Number - Region: 170-192,219-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0511
Family PAPS sulfotransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025507   Gene: ENSONIG00000020242   Transcript: ENSONIT00000025528
Sequence length 339
Comment pep:known_by_projection scaffold:Orenil1.0:GL831152.1:481769:502960:1 gene:ENSONIG00000020242 transcript:ENSONIT00000025528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRVIRMVFALSLGCFVMVIFYFNSSLKPASEAVGEGSSRQKSRRSPLQTLYDGDQVE
SAVQAIHQGRRELLEEACRSYTRKRRVLIPEDLKHIIVDDQHGLLYCYVPKVACTNWKRV
LMVLTGVAGSNTDPLAIPANEAHIPGNLRTLSEYSTSQINQRLRSYLKFVFVREPFERLV
SAYRNKFTRSYNTAFHKRYGTKIVRRHRPDPQPEALERGNDVSFEEFVYYLVDPATQREE
PFNEHWERVHSLCHPCLIHYDVVGKYETLEQDSRYVLQLAGVEDQVSFPASSKSTRTTGD
MAAQFFHNISPFYQKKLYNLYRMDFLLFNYSVPAYLKFR
Download sequence
Identical sequences I3KWL1
ENSONIP00000025507 XP_003442716.1.78416 ENSONIP00000025507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]