SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025553 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025553
Domain Number 1 Region: 17-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.38e-47
Family G proteins 0.0000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025553   Gene: ENSONIG00000020279   Transcript: ENSONIT00000025574
Sequence length 186
Comment pep:known_by_projection scaffold:Orenil1.0:GL831152.1:2681750:2686629:1 gene:ENSONIG00000020279 transcript:ENSONIT00000025574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALINRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKV
TKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLDKPQL
QGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSVSCKEKDNIDITLQWLIQH
SKSRRS
Download sequence
Identical sequences E6ZFP0 I3KWQ7
XP_003442665.1.78416 XP_004571996.1.88231 XP_005752976.1.53837 XP_005915312.1.24487 XP_006784790.1.46954 XP_020448760.1.23826 XP_022044406.1.10920 ENSONIP00000025553 ENSONIP00000025553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]