SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025695 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025695
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-28
Family G proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025695   Gene: ENSONIG00000020390   Transcript: ENSONIT00000025716
Sequence length 230
Comment pep:novel scaffold:Orenil1.0:GL832295.1:5341:6060:-1 gene:ENSONIG00000020390 transcript:ENSONIT00000025716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLESTTMRLVLLGKTGSGKSHLGNTILGEELFATYPSPNSGTIECQTETKTVSGRSITLI
DTPGFFDTGRSEADLNSEIMSCMTECAPGPHAFLIVLRVDKFTEHEQAVITKTVQYFSDE
ALKYAVVVFTHGDQLDENLKIEDFVSQNKNLSDLVSKCGGRCHVFDNKHWNNNQVEELLK
TIEKMVAERNGGYYTNKMLQHVETAIREQVEHIRQSMPDKTTEEIRKQAK
Download sequence
Identical sequences I3KX49
ENSONIP00000025695 ENSONIP00000025695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]