SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025726 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025726
Domain Number 1 Region: 375-495
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-26
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 2 Region: 498-536
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000011
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025726   Gene: ENSONIG00000020421   Transcript: ENSONIT00000025747
Sequence length 536
Comment pep:known_by_projection scaffold:Orenil1.0:GL831157.1:2120939:2122549:1 gene:ENSONIG00000020421 transcript:ENSONIT00000025747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKISLKTIRKSLSIKGKEEGDFVMLQQPSVTAEFSKDESLFGGCYTKELSACDIASEDE
KGGQNKGRSKSETLMGSLKRRLSTKQKAKVKGGTSTIGSVDDEDTFSSSSVPISFNEVKA
QRPLRSASLRSHHYSPSPWPLRSVNSDDACIKMEVKVKAMVHSPSPSPNLNGVRKEFHDF
QMEGLLQDQAESLKNLQQPQNGELHLNIDENDVPVVLGLTPQDYIQYTMPLDEGMYPEGS
HSFCLEGSSPMEVVTEADNGSLHTEQGQEEHELVNGMPPDIFMETSVNSILIGSAGMMLQ
NSRVEMPPPLSPLLPPMTSNGHIPRTFSGFSSADSQVAERVRHHLNFDPNSAPGVSRVYD
SVQSSGPMVVTSLTEELKKLARQGWYWGPITRWEAEEKLVNLADGSFLVRDSSDDRYLLS
LSFRSQSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYSRSRLPG
SATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences I3KX80
ENSONIP00000025726 ENSONIP00000025726 XP_005471839.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]