SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025886 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025886
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.06e-54
Family G proteins 0.000000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025886   Gene: ENSONIG00000020581   Transcript: ENSONIT00000025907
Sequence length 202
Comment pep:known_by_projection scaffold:Orenil1.0:GL831174.1:3777722:3778330:-1 gene:ENSONIG00000020581 transcript:ENSONIT00000025907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKNLLLKVILLGDGGVGKSSLMNRYVTDRFDSQSFHTIGVEFLNRDLEVDGRLVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFAVNNLQSFQNLGSWKKEFMYYSDVKDPERFPFV
VLGNKIDMEQREVGEDEARAWCEENGCCPYFETSAKDDTNVTAAFEAAVREVLAAEDQID
HALLSSTIDLHGNRKTSRRSCC
Download sequence
Identical sequences I3KXP0
XP_003445934.1.78416 ENSONIP00000025886 ENSONIP00000025886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]