SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026079 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026079
Domain Number 1 Region: 11-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.07e-28
Family G proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026079   Gene: ENSONIG00000020774   Transcript: ENSONIT00000026100
Sequence length 296
Comment pep:novel scaffold:Orenil1.0:GL831201.1:1282365:1283252:-1 gene:ENSONIG00000020774 transcript:ENSONIT00000026100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCLSTEPIRRNDEVLRIVMVGKTGSGKSATGNTILGGDFFPSRFSFKSITVHCSKAEAVV
DGQKVAVIDTPGLFDTTFGMDKAAKDFSQCISYASPGPHIFLVVIKLGRYTEEEMLTVQK
IQEAFGQAADKYSMVLFTGGDQLEDTSIEEFLGENLELQELVARCNGQYHVFNNKKKDRA
QVTELLMKIRSIVQKNGGSHYTNEMFQEAEREIEEEKQQVLKEKEEQIRREREELEKKMQ
ETYEKEMKKITEQLQNEIERLNMMRRLEEQHQREAAEAQRRLWEAQLQKARREAER
Download sequence
Identical sequences I3KY82
ENSONIP00000026079 ENSONIP00000026079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]