SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026111 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026111
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-57
Family G proteins 0.0000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026111   Gene: ENSONIG00000020807   Transcript: ENSONIT00000026133
Sequence length 176
Comment pep:known_by_projection scaffold:Orenil1.0:GL831260.1:1273698:1274228:1 gene:ENSONIG00000020807 transcript:ENSONIT00000026133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKF
NVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILI
FANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS
Download sequence
Identical sequences A0A087YQL1 I3KYB4 W5LTZ3
ENSONIP00000026111 ENSAMXP00000026609 ENSONIP00000026111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]