SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026177 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026177
Domain Number 1 Region: 554-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.72e-26
Family G proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026177   Gene: ENSONIG00000020874   Transcript: ENSONIT00000026200
Sequence length 1511
Comment pep:novel scaffold:Orenil1.0:GL831189.1:3075186:3079718:1 gene:ENSONIG00000020874 transcript:ENSONIT00000026200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLSLRRILGINKETITDESAKCKSDLPWYFLKKVMMFNVTARNVKCTSECDSTSDDTSGT
KKLNLKNLVSSPNTEDTVNPLDIITALFLCSDGFLQQEMALKMSMCQFSVPLLLPNCDTG
QCTLMLWAMRDIVKKYRPQSLSQSKGFIEERIVLSELPMVSFVRLGECSLSKSEILNKVL
SNSQQYHDTFVHYNMECGDSPRIISNGLTEITWYLPGGNTNIDIFSQPVAVANLRGDIAS
FETQYSFLCQTSAAVFVFFDYLDSDYESVINLLKSQNKKAQIFLVGNYESKRFNLDALEK
VATELDLTENNIILKRKQKNDANFVKDLRKTVRNVVEKLELKMKIEKMVDVAHELGILVD
EDAPECQTAKKNAKTITEEIQDIHKYKEDELPRQGQIWETLTCLEKEEFRLRHVESKNVE
HYKSDLQKQKEELRKKQNSYEMSTAMTNFITGISNPGTERFYFLKWMRMNLDNVSRVRLC
ELREKYKEKCKNSENKEEIKEIDKQISSSSLGTEHFFREMGQIYESSLSLPKTNRSRQQL
QHLPKLCAELLLDGFPLELVDGDASNIPLRWVSDVLSQLSDLVSPKTKRNKGKIRVVTVL
GVQSTGKSTLLNTMFGVQFAVSSGRCTRGAFMLLIKINEDMKNVLNCDFLVIIDTEGLKS
PELAQLDNSYEHDNELATLVVGLSDVTIVNIAMENLIEMKDILQIVVHAFLRMKEVGKKP
KCQFVHQNVSDVSAHEKNLRDRKLLLDQLNEMTQAAAKMEKKEGNKSFTDVMEYSPDTGN
WYIPGLWNGNPPMAPVNAGYSEAVYELKKNIIQLLENCESSANDVMEFKEWVRSLWNAVK
HENFIFSFRNSLVADAYMKLCTQFNKWEWELRKEMYTWVRNAETKIHNFGTIAAKSETSD
MREFLGSLKSEASTVLSTWETKILDNLTQYFKQTEGHVYLVEGYKEEFSNSAKLLRLEIE
SGVKYQLEAAAEIRQGMTEIDKIRHNHIKEIEKAVRALIDKCRKKKVKMTNRELDKEFEK
MWSETLEKLSFSQQKTSNVTDRVSYCLRENLKHKGSRANELLSQQNLQDCGNESFKYTAE
GFFGKVKHKTKKWFTGQDHIKDLADRIIAACTDLVNEQVKRRNDYHDTYIQEILRMTDEK
LKNHQDVKINIEFEVSLKQHICGFAARKFQKMHKDFIEENDPYRCLLKNKEKFHEDFKDV
FHERDQCQKKAEEFTKRCLKPAVEDFVNRSLGPDIIDEMRKLEQFSTRMSFQYSILLDLL
SKEDFQNYVSYIRSYEKYVKTWILKQIKKHFSNKSTVFEFENRHLQSCIDSINSAIIKAK
TRKSDDFKAFVKEICKELGDKLVITQDALGAFMILNNADKEQFADCLKTSVSDMTETLRN
KFKKSTFEIKLQHLHVNPQNELFNKLIGCGKQCPFCKAPCDAGGKAHTEHFASLHRPEGL
GRYRWEWTERLVTDICSSSVISDNRFRCSHTNNEWHPYKKYKKIYKDWAIQPDKSLEASD
YWKYIMTKYNR
Download sequence
Identical sequences I3KYI0
ENSONIP00000026177 ENSONIP00000026177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]