SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026362 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026362
Domain Number 1 Region: 382-491
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-27
Family SH2 domain 0.00000149
Further Details:      
 
Domain Number 2 Region: 494-535
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000288
Family SOCS box-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026362   Gene: ENSONIG00000021059   Transcript: ENSONIT00000026385
Sequence length 545
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:7806174:7807811:-1 gene:ENSONIG00000021059 transcript:ENSONIT00000026385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPKDSGNRGKDRERGARPKVRQSRSEERRDAGGGRKGGKGKKKGLSSHDAAAERPVSD
GFEYGELLSELETRDQSSPSPLRDSWRWQGFEVAASLLGQERVTAKPTLGATGSAAELPT
SSEGEGRGSSSSRTLRQKIQDAMGQCFPIKTHTAAAPAPPPQALSSSSACGSSRRKIHLS
ELMLDDCPFPVGSELAQKWYLIKQHTAPITQPPLLDSTVVCTAPTSTMAAAVEDVDDRLR
ERRRISIEQGVEPPPNAEIHTFEVTAQINPLYKHGPKLAHGMNDLAETDRSSIHQQQQLL
LQRQQQHQLLLQSCLDTLDEVAASASASASVHTCDAVSDALVDPDITATSMTSRAILPQT
EHHKSHDSYRIHTQIDYIHCLVPDLLQITNLPCYWGVMDRYEAETLLEGKPEGTFLLRDS
AQEDYLFSVSFRRYGRSLHARIEQWNHNFSFDVHDPSVFHAPTVTGLLEHYKDPNSCMFF
EPLLSNPIHRTQPFSLQHICRAVISSCTTYDGINMLPIPNALKKHLKEYHYKQRVRVRRM
DTWWE
Download sequence
Identical sequences I3KZ15
ENSONIP00000026362 XP_005474779.1.78416 ENSONIP00000026362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]