SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026496 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026496
Domain Number 1 Region: 6-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.96e-44
Family G proteins 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026496   Gene: ENSONIG00000021194   Transcript: ENSONIT00000026520
Sequence length 208
Comment pep:known_by_projection scaffold:Orenil1.0:GL831278.1:929514:930140:1 gene:ENSONIG00000021194 transcript:ENSONIT00000026520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFEVKEKTEVRLVFLGAGGVGKTALIQRFLKDTFEPKHRRTVEELHRKEYEVGGVKVTI
NIMDTSGSYSFPAMRRLSIQNSDAFALVYAVDDPDSLEAVKSLRDEILEIKEDKYTPIVV
IGNKIDRNNERQVSSQDVESTVELDWNHSFLESSAKDNINVLEAFRELLQQANLPSWLSP
ALCRRRETFPKDSNKRPPMNKTNSCLLS
Download sequence
Identical sequences I3KZE9
XP_005468345.1.78416 ENSONIP00000026496 ENSONIP00000026496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]