SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026540 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026540
Domain Number 1 Region: 21-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-46
Family G proteins 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026540   Gene: ENSONIG00000021238   Transcript: ENSONIT00000026564
Sequence length 201
Comment pep:known_by_projection scaffold:Orenil1.0:GL831200.1:3278751:3279356:-1 gene:ENSONIG00000021238 transcript:ENSONIT00000026564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQLTDIAPSTPFLPSFQCLHVVVIGLDSAGKTSLLYRLKLKEFVKTIPTKGFNTEKIK
VAVGASRGINFQIWDVGGQDKLRPLWKSYTRRTDGMVFVVDSTELERMEEAKVELHKITR
TSENQGVPVLILANKQDLDSASSVSEVEKLLSVHELSMYTLYHVQSCSAVDGQGLQLGLE
KLYEMILKRKKMVKHNRNRKR
Download sequence
Identical sequences I3KZJ3
ENSONIP00000026540 XP_003448716.1.78416 ENSONIP00000026540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]