SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026715 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026715
Domain Number 1 Region: 9-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-45
Family G proteins 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026715   Gene: ENSONIG00000021413   Transcript: ENSONIT00000026739
Sequence length 195
Comment pep:known_by_projection scaffold:Orenil1.0:GL831245.1:1866513:1867100:1 gene:ENSONIG00000021413 transcript:ENSONIT00000026739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFPEMSIKCVLVGDSAVGKTALLVRFTSETFPDTYKPTVFDNTGVEVYMDGIQISLGL
WDTAGNDSFKQIRPRSYQQADVVLICFSVANPHSLASVQNKWINEVRQHLPRVPVLVVAT
QTDLREMGGHRGTCITPTEGKHVAQDVRAKGYLECSSLSNRGVQQVFEYAVRTVVNQAKK
QARRRMFSMNQCKVF
Download sequence
Identical sequences I3L018
XP_005456934.1.78416 XP_005456935.1.78416 ENSONIP00000026715 ENSONIP00000026715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]