SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002948 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002948
Domain Number 1 Region: 17-91,135-300
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-63
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 342-640
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.75e-42
Family Extended AAA-ATPase domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002948   Gene: ENSONIG00000002357   Transcript: ENSONIT00000002949
Sequence length 723
Comment pep:known_by_projection scaffold:Orenil1.0:GL831169.1:314383:323005:1 gene:ENSONIG00000002357 transcript:ENSONIT00000002949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKDYEAEKEKCKRFLQEFYTEDDNGKKLFKYGAQLVALAHREQVALFVDLDDVAEEDP
ELVESICENAKRYTALFADAVHELLPEYKERDIVAKDSLDVYIEHRLMMEQRGRDPADTR
DPRNQYPPELMRRFELYFKAPSTSKPKVVRDIRADSIGHLVAVRGIVTRATEVKPMMAVA
TYTCDQCGAETYQPIQSPSFMPLVMCPSQECVTNKSGGRLYLQTRGSKFIKFQELRIQEH
SDQVPVGNIPRSMTVYVRGENTRLAQPGDHVAITGIFLPLLRTGFSQAVQGLLSETYLEC
HSITLMNKTEDDELGNEELTDEELRSITDEGFYEKLAGSIAPEIYGHEDVKKALLLLLVG
GVEQAPKGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMR
DPLTGEMTLEGGALVLADLGICCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNA
RCSILAAANPAYGRYNPRKSIEQNIQLPAALLSRFDLLWLIQDKPDADADLRLAQHITYV
HQHSRQPPTHFTPIDMKLMRRYISLCKKRQPVVPESLADYITAAYVEMRKEARVSKDTTF
TSARTLLSILRLSTALARLRMMDTVEKEDVNEAMRLMEMSKDSLQADKSSTTRTQRPADV
IFSLVRELAAEGRGAGGLVRMAEAEQRCVSRGFTPAQFQEALEEYEELNVWQVNQARTRI
TFV
Download sequence
Identical sequences I3J258
ENSONIP00000002948 ENSONIP00000002948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]