SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003343 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003343
Domain Number 1 Region: 649-1029
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.28e-88
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00012
Further Details:      
 
Domain Number 2 Region: 47-310
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.88e-65
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000153
Further Details:      
 
Domain Number 3 Region: 319-645
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.62e-63
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000128
Further Details:      
 
Domain Number 4 Region: 1082-1255
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.55e-40
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003343   Gene: ENSONIG00000002670   Transcript: ENSONIT00000003344
Sequence length 1271
Comment pep:known_by_projection scaffold:Orenil1.0:GL831309.1:1117910:1127401:-1 gene:ENSONIG00000002670 transcript:ENSONIT00000003344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAHAYKRTALKPDLHSSLTMRGLVFFFCCLVALATCQAARYDLSLNHRKTYEYTYEGEV
KFGLGKPNRAKSGARIKCNIKISGESPQAFILQVSDVTFAELNGISGKSDFNQSPKLTQR
LAAQLAKPFKFEHSNGHVRQIQAAPDVSETTVNIVRGILSFFHATVKTSPTVYELEEAGI
HGMCQSNYATEINKQTNNMNITQVVDIDNCRMKAAMQNGMASAVLDKDSKQRGESVISTV
QYLYTIQPTEEGGIVKSAYGLEQQHFSPFNVKRGSFRMEAKKEMVLIRVSEGGKPANVGQ
LQNRGDLVYKLVNSDVNIPLVMQDLAEPKAKAVRMIKQLAEDHKNQINRETTEDTLKVYQ
LLRMLQDRDLDEMWVELARNDEHRRFFLDMIVEINDDRVLKFLKKRFQAKDVSANEAVQA
LLIAMNHLQPRAELVEKAKEIMNMEFIKSNLHMWPAAVFSFGSLVYKYCAYHSPCPQSAV
QPLLDLANEGLRNRNETEMVIALRALGNAGHPGSIKTIANFLPGVAANPVDVSCRVQSAA
VQALRLTARRNPHNVQEIALKVFLQKNCAPETSMLAIMVMFNTKPSAALVSTLTAHLERE
KDIHLASFAYSYLENIARSKTPDNHYLSIYCSLAVKSLAAKFGRLSYNSRSLQVDMFDDD
LLMGTSASINVLGGPTSVLPTEIMSKNKYFAIGRIMRLMEFGIRAESLKQLFGPSIPGFK
GDFSSSDFQAIYNVLKNWESLPNDKPIMSAYSRSSGQEIFFVNIKKDLLEYIKAAVSPSA
PKGTPVWAAIELLQKGFSWHWTKPLLSIEARLLQATTLGLPVEIAKYYQTVTGITMNAKA
AINPPQTQRLGDLLNADISLESEGVMGFTKDFWIFHGINTELFQCGSELKSKAPVELPFK
LSAKLNVGKKLLELDIPACKKEFELISVSSNVYAVSRNIGDPESPKRTPMIPDESNSQQQ
PTPNNWHRKANMCAKSSIYGVGVCVDYEIRRQYFNNEYPLYSILGFTQAAIRVVPAEATK
PVEKIHLEVNGNPTSHPMTIRHLYETMRRISKERSQEQSNSASNERETRNSQEIMMDATA
PQPVVSIKAIAMSGNQNLEGFDVTLYNPSEGDTLKAQMIVSHVGDAANWKMCVDASAQSP
AQSSANLKAKISWGAQCKPYEISVTAAAAQSSASRPTLEAKVQWANVPEEMANYCSSMER
YIPGMALLSGFNQTWESNANQEVSASIVSASSDSIDITIKLPKYTVFRQAVPLPFSSTSF
REENAERNGQA
Download sequence
Identical sequences I3J3A3
ENSONIP00000003343 XP_005459969.3.78416 ENSONIP00000003343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]