SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003617 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003617
Domain Number 1 Region: 583-678
Classification Level Classification E-value
Superfamily TAFH domain-like 5.75e-35
Family TAFH domain-like 0.0000442
Further Details:      
 
Domain Number 2 Region: 829-877
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000544
Family TBP-associated factors, TAFs 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003617   Gene: ENSONIG00000002889   Transcript: ENSONIT00000003618
Sequence length 1045
Comment pep:novel scaffold:Orenil1.0:GL831133.1:4778871:4869823:1 gene:ENSONIG00000002889 transcript:ENSONIT00000003618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLAGQSNPAGKADENGGAGSVAPSNHHLGK
TLPAPVSTTTLEQQQQQQGRRNKTEMRQEINSKDVSPDKTVTSPSPGCSPSFGEPSTTSG
ACVSATSSGSQSHGASITTLTASGVSTLASSPPASISTTTSSRGSKVTVGTGETSTGATP
PRKRITTPRRSASARIKSLNGAAVTTRRNSNTAVVDNVSPVDTSASTPNCGRPVTTSINT
STFTLSNASLPVGQSAIALDRGTPTIALHRLPSHIVASIAQNGNGTSVSALVQQGARIGP
VTSSASPGNQTKMVTDTGASKTDDCQSKIVMLTQSSGVNSVVNTVSTSSPPLPPPSSTSS
SSIVTPPTTTTAAATTTITITQPLSSITPAACVTGMATISACGAGQTTSVTTTITMVRPT
APSPTPAVATSAQSQPRPGLTAPQRIVTPQLIVRPPQQQTTIQLPPGFTIPQGMVLVRTE
LGQLVMVPQQALAQAQAQAQAQAQAQAQNNISPRPATPTTGTSFRVTSPQKGPVAPVVAV
TAPQQTPVVLPPQAPAQPASQPVQPAQPAIATASGASVASQEMQENVKKCKNFLATLIKL
ASHNSPSPETSKNVKALVQDLLDAKIEPEEFTSRLQTELKSSPQPYLVPFLKKSLPALRL
SLLNSQQSLTQPPQQGLKPAPCGTPPAIVAGPAVRIRHPNSVSTTTGASALPAGTLGHAA
AMGVKTGGAVGGQVRMPVVITQSIRAQGTMGKGAIIQAGKSPMGLPVQITGNQKNKLNDP
GGGTFRDDDDINDVASMAGVNLNEESARILATNSDLMGTQIRSCKDEAFLHPGLLHRRIQ
ETAKKFGITEVPMETVTFISHATQSRLRTVVEKVSTIAQHRLDSCKDDECYEQSADVRSQ
LRFFEQLERIEKQRKDEQEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRD
ANLTALAAIGPRKKRKVDSPGATPSGTEVSGSTAGSPASSSAPSTSSRQYTRQRITRVNL
RDLIFYMEQERETAHSLLLYRALLK
Download sequence
Identical sequences I3J427
ENSONIP00000003617 ENSONIP00000003617 XP_019216113.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]