SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003662 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003662
Domain Number 1 Region: 2-552
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-87
Family Acetyl-CoA synthetase-like 0.00000965
Further Details:      
 
Domain Number 2 Region: 707-1047
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.02e-48
Family Quinoprotein alcohol dehydrogenase-like 0.0031
Further Details:      
 
Domain Number 3 Region: 541-595
Classification Level Classification E-value
Superfamily ACP-like 0.0000445
Family Peptidyl carrier domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003662   Gene: ENSONIG00000002923   Transcript: ENSONIT00000003663
Sequence length 1053
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:7857024:7864186:1 gene:ENSONIG00000002923 transcript:ENSONIT00000003663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLQELVAAAASLHADRLAVTHSVSGKPPVSLTYRDLVQLADEFSRALRKNCSPSSGVIG
LYCRDDLFVPVWILGILQSSAAYVPLDPESPGLLSARVMSQCGLKYCAVQTDLLQKYKTF
AKHINFPWFKTERRDTSLEWMQYQNTIVNSLLKKGAGQTETLSVNDLSGSAVQQDDAGCR
ELAYVLHTSGTTGFPKTVRVPHRCILPNILHLRSLFQMRPDDVVFLASPLTFDPSVVDIF
LALSSGAQLLIVPNVIKKMPNRLAELLFNDHKTTVLQVTPTLLLHFGHRILKQDVLSCSS
SLRVLALGGEACPSPALLESWRHKDNKTNIYNIYGITEVSCWASCYRIPESLLQSSNLTV
SSVPLGTPLMGTVVEVRDEHGCVVSEGEGQIFIGGEDRVCLLDDEDTVVPGTMRATGDWV
NVKDGQLHYLGRRDRMIKRNGKRVNLDSLQQVLLSLPQVEACAVGLHQGFRLLAFVMASN
GDLKKLILSQLSLLLPAHSVPDTLVLVPTLCLTAHGKVNMEALVRVYEKQRQCLESSQRN
SSELRQILQTLWRDTLNLAVDVTIDKKSNFLLSGGDSLKALHLCEDILAAVGVTSPELLE
VILDGTFSDIMNHVARARGILEHENSESTLSQAKRRHDESTSQVLEKRVRKDWTATESLQ
VEKQAVKVIRRGGEVIEMNIRYTEDDKTVQNQLLGVRESCGEADLGLSLSWSSDTGRCVD
ASPVLLVQNRADHRATVFIGSHSHRIQAVDVATGNLMWERVLGDRIEGSAAVSRCGSLVV
IGCYDGCVYFLCTETGNTQWVFETGDAVKSCPAVDPLTGLVVVGSHDGHVYALNSEVRKC
VWKCHCGGGAVFSSPRLHPSRRQVYAASLGGHLLCLSIDSGDVLWSYCRDTPFFSSPNCF
SEHVVIGSVDGHICCFSNMGKLLWQFLTKGPVFSSPSITSDQKRLLCGSHDGCLYCLNCA
DGSLVWTFQTTGKVYSTPFVFDGSAVGRRGSLVGLASTDGTVWILDGKDGRMLASHTLPG
ELFSSPVVWERSLLVGCRNDYVYCLSLSVKKET
Download sequence
Identical sequences I3J472
ENSONIP00000003662 ENSONIP00000003662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]